Bordetella sp. H567: AKI39_07705 Help Entry AKI39_07705       CDS       T04979                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism boh  Bordetella sp. H567 Pathway boh01100   Metabolic pathways boh01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:boh00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AKI39_07705    00074 Mycolic acid biosynthesis     AKI39_07705   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AKI39_07705 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 DUF1896 Ribosomal_L50 HLH EutQ DUF1493 Motif Other DBs NCBI-ProteinID:  AOB30601 UniProt:  A0A1B2R0T6 LinkDB All DBs Position 1700815..1701054 Genome browser AA seq 79 aa AA seqDB search MESIEQRVKKIVAEQLGVNEAEIKNESSFLDDLGADSLDMVELVMALEDEFETEIPDEEA EKITTVQQAIDYIGSHGKQ NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggaaagcatcgaacagcgcgtcaagaagatcgtcgctgaacaacttggcgtcaatgaa gccgagatcaagaacgaatcttcctttcttgacgacctcggtgccgattcgctcgacatg gttgagctggtgatggctctcgaagacgaattcgagaccgagatccccgacgaagaggcc gagaaaatcacgaccgtgcaacaagcgattgactacatcggttcgcacggcaagcaataa

DBGET integrated database retrieval system