Bordetella sp. J329: CBF45_04565 Help Entry CBF45_04565       CDS       T05850                                  Name (GenBank) hypothetical protein   KO K16249   phenol/toluene 2-monooxygenase (NADH) P0/A0 Organism boj  Bordetella sp. J329 Pathway boj00361   Chlorocyclohexane and chlorobenzene degradation boj00362   Benzoate degradation boj00623   Toluene degradation boj01100   Metabolic pathways boj01120   Microbial metabolism in diverse environments boj01220   Degradation of aromatic compounds Module boj_M00548   Benzene degradation, benzene => catechol Brite KEGG Orthology (KO) [BR:boj00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     CBF45_04565    00361 Chlorocyclohexane and chlorobenzene degradation     CBF45_04565    00623 Toluene degradation     CBF45_04565 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Phenol_hyd_sub Motif Other DBs NCBI-ProteinID:  AZV93084 LinkDB All DBs Position complement(1052398..1052643) Genome browser AA seq 81 aa AA seqDB search MSALTTDDTSIPLPTVDLSKRYVRVTGQRDNGFIEFEFSVGWQELVVELILMPPDFKAFC EANHVEMLPPHEEGHEDGHED NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgagtgccctgacgacagacgacacctccatcccgttgcccaccgttgacctgagcaaa cgctatgtcagggtcactggccagcgtgacaacgggttcatcgaattcgaattttccgtg ggctggcaggaactggtcgtcgaactgatcctgatgccccccgacttcaaggccttctgc gaagccaaccacgtggagatgctgccgccgcacgaagaagggcacgaggacggacacgaa gactga

DBGET integrated database retrieval system