KEGG   Bordetella sp. J329: CBF45_16375
Entry
CBF45_16375       CDS       T05850                                 
Name
(GenBank) 50S ribosomal protein L18
  KO
K02881  large subunit ribosomal protein L18
Organism
boj  Bordetella sp. J329
Pathway
boj03010  Ribosome
Brite
KEGG Orthology (KO) [BR:boj00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    CBF45_16375
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:boj03011]
    CBF45_16375
Ribosome [BR:boj03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    CBF45_16375
  Bacteria
    CBF45_16375
  Archaea
    CBF45_16375
SSDB
Motif
Pfam: Ribosomal_L18p sCache_3_3
Other DBs
NCBI-ProteinID: AZV95101
LinkDB
Position
complement(3696402..3696758)
AA seq 118 aa
MNKNLSRLRRAVPTRRKIAELGAHRLTVFRSNLHIYANIISPEGNRVLVSASTQEAEVRK
LLEGNGGNVAAATLVGKRVAEKAKAAGIESVAFDRSGFRYHGRVKALAEAAREAGLKF
NT seq 357 nt   +upstreamnt  +downstreamnt
atgaacaagaatctttcccgtttgcgtcgtgcggtgcctacccgccggaaaattgccgaa
ctgggcgctcatcgcctgacggttttccgttcgaacctgcacatttacgcaaacatcatt
tcgccggaaggcaatcgcgtgctggtcagcgcctccacccaggaagccgaagtccgcaag
ctgctggaaggcaatggcggcaacgtcgccgctgcgaccctggttggcaagcgcgtggcc
gagaaggccaaggccgctggcatcgaaagcgttgctttcgaccgctcgggtttccgttat
cacggtcgtgtgaaggccttggccgaagccgcgcgtgaagccggtctcaagttctaa

DBGET integrated database retrieval system