Burkholderia oklahomensis EO147: DM82_1392 Help Entry DM82_1392         CDS       T03284                                  Name (GenBank) cyd operon protein YbgT   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism bok  Burkholderia oklahomensis EO147 Pathway bok00190   Oxidative phosphorylation bok01100   Metabolic pathways bok02020   Two-component system Module bok_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:bok00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     DM82_1392  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     DM82_1392 Enzymes [BR:bok01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      DM82_1392 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB DUF6350 Motif Other DBs NCBI-ProteinID:  AIO66162 UniProt:  A0AAI8FMX2 LinkDB All DBs Position 1:1587241..1587501 Genome browser AA seq 86 aa AA seqDB search MIGIVHASPPARAGGAPSNRPAARAAGLSVKEAAMWYFSWILGIGVALGFGIINAMWLEA NGTLPADASDDKSRADRPAVSEGGRS NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgatcggcatcgtgcacgcgtcgccgcccgctcgtgcgggcggcgcgccctcgaatcgt ccggcggcccgcgccgccggcctgtccgtcaaggaggctgcgatgtggtacttctcatgg attctcggcatcggcgtcgcgctcggcttcggcatcatcaacgctatgtggctcgaagcg aacggcaccctcccggccgacgcctccgacgacaagagccgggcagacaggcccgctgtt tcggagggcggccgttcgtga

DBGET integrated database retrieval system