Burkholderia oklahomensis EO147: DM82_4025
Help
Entry
DM82_4025 CDS
T03284
Name
(GenBank) sugar (and other) transporter family protein
KO
K08151
MFS transporter, DHA1 family, tetracycline resistance protein
Organism
bok
Burkholderia oklahomensis EO147
Brite
KEGG Orthology (KO) [BR:
bok00001
]
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
bok02000
]
DM82_4025
01504 Antimicrobial resistance genes [BR:
bok01504
]
DM82_4025
Transporters [BR:
bok02000
]
Major facilitator superfamily (MFS)
Drug transporters
Drug:H+ antiporter-1 (12 spanner) (DHA1) family [TC:
2.A.1.2
]
DM82_4025
Antimicrobial resistance genes [BR:
bok01504
]
Gene variants
Tetracycline resistance genes
Transporters
DM82_4025
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
MFS_1
MFS_1_like
Sugar_tr
MFS_2
LacY_symp
TRI12
Motif
Other DBs
NCBI-ProteinID:
AIO69918
UniProt:
A0AAI8BBS5
LinkDB
All DBs
Position
2:complement(313586..314836)
Genome browser
AA seq
416 aa
AA seq
DB search
MPRQIVVVLLTLAVDAIGMGVAAPVLPDLLRAIEYGPANVPLLLGVLMTCAALMQFVFGP
LLGTLSDALGRRPVLLAALLGNAVAFLLLASVRDFTWLLAGHLLVGATAASTGVATAYLA
DVTPPSLRAARFGLASGVVGLGLVAGPAFGGLLGTLGPRVPFYAAGALAVCNCVSAVLAL
PESLPATQRNPVAWRRANPFGSLALVRQDRRFRRLSFAVCCGMMAYGIYLTCFVISNEQR
IGWGPKENGMALAMLGLGITLTQSFVLPRLVSRLGERKTAIAGYALFVPAYVCYSVADSP
AAVIIAIVLHALALVSDPAVRTMISLLASAGRQGEYQGALVCLMGLAASCAPIAGANLFH
FFADPSSPLRLPGAPFLVAAALYVLSLAAVLRSDAGTRTQAQTVPFPPYAREDSHD
NT seq
1251 nt
NT seq
+upstream
nt +downstream
nt
ttgccccggcagatcgtcgtggtactgctgacgctcgcggtggacgcgatcggcatgggc
gtcgcggcaccggtgctgccggatctgctgcgggcgatcgagtacggccccgccaacgtg
ccgctgctgctcggcgtgctgatgacgtgcgcggcgctcatgcagttcgtcttcgggccg
ctgctcggcacgctgagcgacgcgctgggacggcggccggtgctgcttgcggcactgctc
ggcaacgccgtcgcgttcctgctgctcgcttccgtgcgcgacttcacgtggctgctcgcc
ggccatttgctcgtcggcgcgacggcggccagcacgggcgtcgcgaccgcctatctcgcc
gacgtcacgccgccgagcctgcgcgccgcccggttcggcctcgcgagcggcgtcgtcggc
ctcggtctcgttgcaggtcccgcgttcggcggactgctgggcacactgggaccgcgggtg
ccgttctacgcggcgggcgcgctcgcggtctgcaactgcgtgagcgccgtgctcgcgctg
cccgaaagcctacctgcgacgcagcgcaacccggtcgcgtggcgacgcgcgaatccgttc
ggcagcctcgcgctggtgcggcaggatcgccgctttcgccgcctgtcgttcgccgtgtgc
tgcggcatgatggcctacggcatctacctcacctgcttcgtcatctcgaacgagcagcgg
atcggctggggaccgaaagagaacggcatggcgctcgcgatgctgggcctcggcatcacg
ctgacgcagagcttcgtcctgccgcgcctcgtgtcgcggctcggcgaacgcaagacggcc
attgccggctatgcgcttttcgtgccggcctacgtgtgctacagcgtcgccgattcgccc
gccgccgtgatcatcgcaatcgtgctgcatgcgctcgcgctcgtcagcgatcccgccgtc
cgcacgatgatctcgctcctcgcgagcgcgggccggcagggcgaataccagggcgcgctc
gtctgcctgatgggattggccgcatcgtgcgcgccgatcgccggcgcgaacctgtttcat
ttcttcgccgatccgtcgtctccgctgcgccttccgggcgcgcccttcctggtcgccgct
gcactgtacgtgctgtcgctcgccgccgtcctgcgcagcgatgccggcacacgcacccag
gcgcagaccgtgccgtttcccccctacgctagagaggatagccatgactaa
DBGET
integrated database retrieval system