Burkholderia oklahomensis EO147: DM82_4172 Help Entry DM82_4172         CDS       T03284                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism bok  Burkholderia oklahomensis EO147 Brite KEGG Orthology (KO) [BR:bok00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bok03036]     DM82_4172    03400 DNA repair and recombination proteins [BR:bok03400]     DM82_4172 Chromosome and associated proteins [BR:bok03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     DM82_4172 DNA repair and recombination proteins [BR:bok03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       DM82_4172 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS FIMAH DUF8104 DUF4600 Frankia_peptide HalX Motif Other DBs NCBI-ProteinID:  AIO70907 UniProt:  A0AAI8BEP8 LinkDB All DBs Position 2:493326..493616 Genome browser AA seq 96 aa AA seqDB search MATYRQLTAQLEKLQHKIDKEREKAIADAIADIKAKIEEYDITPEELGFRSVKATAKPKR SLPPKYLNPKTGETWSGRGRAPAWLGKNRNRFLIKD NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atggcgacctataggcaactgaccgcacaactcgaaaaacttcaacataaaatcgacaag gaacgcgaaaaagcgatcgcggacgccattgccgatatcaaggcgaagatcgaggaatac gacatcaccccggaagagttgggattcaggagtgtcaaggctacggcgaagccgaagcgc tcgctgccgccgaagtacctcaatccgaagacgggcgagacctggagcggccgcggtcgg gcgccggcttggctcggcaagaatcgcaaccgcttcctgatcaaggactaa

DBGET integrated database retrieval system