Brucella canis Oliveri: BCOUA_I1876 Help Entry BCOUA_I1876       CDS       T03030                                  Symbol grxC Name (GenBank) grxC   KO K03676   glutaredoxin 3 Organism bol  Brucella canis Oliveri Brite KEGG Orthology (KO) [BR:bol00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:bol03110]     BCOUA_I1876 (grxC) Chaperones and folding catalysts [BR:bol03110]  Protein folding catalysts   Protein disulfide isomerase    BCOUA_I1876 (grxC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin Glrx-like GST_N_3 GST_N_2 SH3BGR GST_N Thioredoxin_4 Thioredoxin_2 Motif Other DBs NCBI-ProteinID:  CDL77247 LinkDB All DBs Position I:complement(1817396..1817662) Genome browser AA seq 88 aa AA seqDB search MVDVIIYTRPGCPYCARAKALLARKGAEFNEIDASATPELRAEMQERSGRNTFPQIFIGS VHVGGCDDLYALEDEGKLESLLKTGKLI NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atggttgacgtcatcatctatacccgccccggctgcccctattgcgcacgggcaaaggcg cttctggcccgaaagggtgccgagttcaatgaaatcgatgcctcggcaacgccggaattg cgcgctgaaatgcaagagcgctccgggcgcaataccttcccgcagatttttatcggctcg gttcatgtcggcggctgcgacgatctttatgcactggaagacgagggcaagctcgagagc ctgctgaaaaccggcaaacttatttag

DBGET integrated database retrieval system