Brucella canis Oliveri: BCOUA_I2086 Help Entry BCOUA_I2086       CDS       T03030                                  Symbol hisE Name (GenBank) hisE   KO K01523   phosphoribosyl-ATP pyrophosphohydrolase [EC:3.6.1.31] Organism bol  Brucella canis Oliveri Pathway bol00340   Histidine metabolism bol01100   Metabolic pathways bol01110   Biosynthesis of secondary metabolites bol01230   Biosynthesis of amino acids Module bol_M00026   Histidine biosynthesis, PRPP => histidine Brite KEGG Orthology (KO) [BR:bol00001]  09100 Metabolism   09105 Amino acid metabolism    00340 Histidine metabolism     BCOUA_I2086 (hisE) Enzymes [BR:bol01000]  3. Hydrolases   3.6  Acting on acid anhydrides    3.6.1  In phosphorus-containing anhydrides     3.6.1.31  phosphoribosyl-ATP diphosphatase      BCOUA_I2086 (hisE) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PRA-PH MazG Motif Other DBs NCBI-ProteinID:  CDL77457 LinkDB All DBs Position I:2013249..2013572 Genome browser AA seq 107 aa AA seqDB search MSQFTLADLERIVAERASVTDGTSYTASLVAKGQPKAAQKLGEEAVETVIAAVSGDRAGV VSESADLLYHLAVVWNIAGVALEDVLQELQRRTAQTGLAEKASRPKG NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atgagccagtttacgcttgcagaccttgaacggatcgtggccgagcgcgccagcgtgacg gatggtacatcctatacggcaagccttgtggcgaaagggcagccgaaggctgcgcagaaa ctgggcgaggaagcggtggaaacggtgatagcagccgtttccggcgaccgtgccggtgtc gtctcggaaagtgccgatctgctctatcatctggcggtggtctggaatattgcaggcgtg gcgctggaggatgtgcttcaggaacttcagcgccgcaccgcccagaccggccttgcggaa aaggccagccgcccgaagggctga

DBGET integrated database retrieval system