Brucella canis Oliveri: BCOUA_II0512 Help Entry BCOUA_II0512      CDS       T03030                                  Symbol ybgT Name (GenBank) ybgT   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism bol  Brucella canis Oliveri Pathway bol00190   Oxidative phosphorylation bol01100   Metabolic pathways bol02020   Two-component system Module bol_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:bol00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     BCOUA_II0512 (ybgT)  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     BCOUA_II0512 (ybgT) Enzymes [BR:bol01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      BCOUA_II0512 (ybgT) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB Hemotin Motif Other DBs NCBI-ProteinID:  CDL78053 LinkDB All DBs Position II:492549..492743 Genome browser AA seq 64 aa AA seqDB search MRATTLTDWKGSKMWYFSWLLGLPLAAAFAVLNAMWYELMDDRARKRLAADPTAELALEG NKHH NT seq 195 nt NT seq  +upstreamnt  +downstreamnt atgagagcaaccacgcttactgattggaaaggaagcaagatgtggtatttttcgtggctt ttgggcctgccgcttgcagccgcgttcgctgtgctgaatgcgatgtggtatgagctgatg gacgaccgggcgcgcaagcgccttgccgccgaccccacggcggaactggcccttgaaggc aacaagcaccactga

DBGET integrated database retrieval system