Bos mutus (wild yak): 102264358 Help Entry 102264358         CDS       T02919                                  Symbol CXCL10 Name (RefSeq) C-X-C motif chemokine 10   KO K12671   C-X-C motif chemokine 10 Organism bom  Bos mutus (wild yak) Pathway bom04060   Cytokine-cytokine receptor interaction bom04061   Viral protein interaction with cytokine and cytokine receptor bom04062   Chemokine signaling pathway bom04620   Toll-like receptor signaling pathway bom04622   RIG-I-like receptor signaling pathway bom04623   Cytosolic DNA-sensing pathway bom04657   IL-17 signaling pathway bom04668   TNF signaling pathway bom05160   Hepatitis C bom05164   Influenza A bom05169   Epstein-Barr virus infection bom05171   Coronavirus disease - COVID-19 Brite KEGG Orthology (KO) [BR:bom00001]  09130 Environmental Information Processing   09132 Signal transduction    04668 TNF signaling pathway     102264358 (CXCL10)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102264358 (CXCL10)    04061 Viral protein interaction with cytokine and cytokine receptor     102264358 (CXCL10)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     102264358 (CXCL10)    04622 RIG-I-like receptor signaling pathway     102264358 (CXCL10)    04623 Cytosolic DNA-sensing pathway     102264358 (CXCL10)    04657 IL-17 signaling pathway     102264358 (CXCL10)    04062 Chemokine signaling pathway     102264358 (CXCL10)  09160 Human Diseases   09172 Infectious disease: viral    05160 Hepatitis C     102264358 (CXCL10)    05171 Coronavirus disease - COVID-19     102264358 (CXCL10)    05164 Influenza A     102264358 (CXCL10)    05169 Epstein-Barr virus infection     102264358 (CXCL10)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bom04052]     102264358 (CXCL10)    00536 Glycosaminoglycan binding proteins [BR:bom00536]     102264358 (CXCL10) Cytokines and neuropeptides [BR:bom04052]  Cytokines   Chemokines    102264358 (CXCL10) Glycosaminoglycan binding proteins [BR:bom00536]  Heparan sulfate / Heparin   Chemokines    102264358 (CXCL10) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  102264358 NCBI-ProteinID:  XP_005909170 UniProt:  L8HRQ8 LinkDB All DBs Position 6:complement(90551874..90554234) Genome browser AA seq 102 aa AA seqDB search MNKSGFLIFCLILLTLSQGVPLSRNTRCSCIEISNGSVNPRSLEKLEVIPASQSCPRVEI IATMKKNGEKRCLNPESKTIKNLLKAINKQRTKRSPRTRKEA NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atgaacaaaagcggttttcttattttctgccttatccttctgactctgagtcaaggcgta cctctctctaggaatacacgctgttcctgcatcgagatcagtaatggatctgttaatcca aggtccttagaaaaacttgaagtcattcctgcaagtcaatcctgcccacgtgtcgagatt attgccacaatgaaaaagaatggggagaaaagatgtctgaatccagaatctaagaccatc aagaatttactgaaagcaattaacaagcaaaggactaaaagatctcctcgaacacggaaa gaggcataa

DBGET integrated database retrieval system