Bos mutus (wild yak): 102264749 Help Entry 102264749         CDS       T02919                                  Symbol CLDN4 Name (RefSeq) claudin-4   KO K06087   claudin Organism bom  Bos mutus (wild yak) Pathway bom03272   Virion - Hepatitis viruses bom04382   Cornified envelope formation bom04514   Cell adhesion molecules bom04530   Tight junction bom04670   Leukocyte transendothelial migration bom05160   Hepatitis C Brite KEGG Orthology (KO) [BR:bom00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     102264749 (CLDN4)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     102264749 (CLDN4)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     102264749 (CLDN4)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     102264749 (CLDN4)   09158 Development and regeneration    04382 Cornified envelope formation     102264749 (CLDN4)  09160 Human Diseases   09172 Infectious disease: viral    05160 Hepatitis C     102264749 (CLDN4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:bom03037]     102264749 (CLDN4)    04147 Exosome [BR:bom04147]     102264749 (CLDN4)    04515 Cell adhesion molecules [BR:bom04515]     102264749 (CLDN4) Cilium and associated proteins [BR:bom03037]  Other cilia and associated proteins   Stereociliary proteins    102264749 (CLDN4) Exosome [BR:bom04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    102264749 (CLDN4)   Exosomal proteins of colorectal cancer cells    102264749 (CLDN4) Cell adhesion molecules [BR:bom04515]  Immunoglobulin superfamily   L1 family    102264749 (CLDN4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PMP22_Claudin Claudin_2 L_HMGIC_fpl TMEM37 TMEM_230_134 Clc-like DUF4131 DUF7139 Motif Other DBs NCBI-GeneID:  102264749 NCBI-ProteinID:  XP_005892912 UniProt:  L8ITH0 LinkDB All DBs Position 25:8610723..8612440 Genome browser AA seq 209 aa AA seqDB search MASMGLQVMGIALAVLGWLGAILSCALPMWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTG QMQCKVYDSLLALPQDLQAARALIVICIILAVFGVLLSVVGGKCTNCVDDESSKAKIMIV AGVVFLLAGLLVMVPVSWTANNVIRDFYNPLVASGQKREMGASLYVGWAAAGLLILGGAL LCFNCPPRNDKPYSAKYSAARSAPASNYV NT seq 630 nt NT seq  +upstreamnt  +downstreamnt atggcttccatggggctgcaggtgatgggcatcgcgctggccgtgctgggctggctgggc gccatcctgagctgcgcgctgcccatgtggcgcgtgacggccttcatcggcagcaacatc gtcacgtcgcagaccatctgggagggcctatggatgaactgcgtggtgcagagcaccggc cagatgcagtgcaaggtgtacgactcgctgctggcgctgccgcaggacctgcaggcggcc cgtgccctcatcgtcatctgtatcatcctggccgtgtttggcgtgctgttgtcggtggtg ggcggcaagtgcaccaactgcgtggatgatgagagctccaaggccaagatcatgatcgtg gccggcgtggtgttcctgctggccggcctgctggtgatggtgcccgtgtcctggacggct aacaacgtcatccgcgacttctacaaccccctggtggcctcgggccagaagcgggagatg ggggcctcgctctacgtgggctgggccgccgctggcttgctgatccttgggggggccctg ctctgcttcaactgcccgccccgcaacgacaagccctactcggctaagtactccgccgcc cgctccgccccagccagcaactacgtctaa

DBGET integrated database retrieval system