Bos mutus (wild yak): 102265151 Help Entry 102265151         CDS       T02919                                  Symbol GAST Name (RefSeq) gastrin   KO K13768   gastrin Organism bom  Bos mutus (wild yak) Pathway bom04081   Hormone signaling bom04971   Gastric acid secretion Brite KEGG Orthology (KO) [BR:bom00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04081 Hormone signaling     102265151 (GAST)  09150 Organismal Systems   09154 Digestive system    04971 Gastric acid secretion     102265151 (GAST)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bom04052]     102265151 (GAST) Cytokines and neuropeptides [BR:bom04052]  Neuropeptides   GPCR binding    102265151 (GAST) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Gastrin Motif Other DBs NCBI-GeneID:  102265151 NCBI-ProteinID:  XP_005899294 UniProt:  L8IBT7 LinkDB All DBs Position 19:28685432..28685889 Genome browser AA seq 104 aa AA seqDB search MQRLCAHVLILVLALAAFCEASWKPHSHLQDAPVAPGANRGQEPLRMNRLGPASHPRRQL GLQDPPHMVADLSKKQGPWVEEEEAAYGWMDFGRRSAEEGDQHP NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgcagcgactgtgtgcacatgtgctgatcttggtgctggctctggccgccttctgcgaa gcttcttggaagccccactcccacctgcaagacgcgcccgtcgctccaggggccaatagg ggccaggagccgctcaggatgaaccggctgggcccagcctcgcacccccggaggcagctg gggcttcaggatccgccacacatggtcgcagacctgtccaagaagcaggggccatgggtg gaggaagaggaagcagcatatggatggatggacttcggccgccgcagtgctgaggaaggg gaccaacatccctga

DBGET integrated database retrieval system