KEGG   Bos mutus (wild yak): 102266295
Entry
102266295         CDS       T02919                                 
Name
(RefSeq) calmodulin
  KO
K02183  calmodulin
Organism
bom  Bos mutus (wild yak)
Pathway
bom04014  Ras signaling pathway
bom04015  Rap1 signaling pathway
bom04020  Calcium signaling pathway
bom04022  cGMP-PKG signaling pathway
bom04024  cAMP signaling pathway
bom04070  Phosphatidylinositol signaling system
bom04114  Oocyte meiosis
bom04218  Cellular senescence
bom04261  Adrenergic signaling in cardiomyocytes
bom04270  Vascular smooth muscle contraction
bom04371  Apelin signaling pathway
bom04625  C-type lectin receptor signaling pathway
bom04713  Circadian entrainment
bom04720  Long-term potentiation
bom04722  Neurotrophin signaling pathway
bom04728  Dopaminergic synapse
bom04740  Olfactory transduction
bom04744  Phototransduction
bom04750  Inflammatory mediator regulation of TRP channels
bom04910  Insulin signaling pathway
bom04912  GnRH signaling pathway
bom04915  Estrogen signaling pathway
bom04916  Melanogenesis
bom04921  Oxytocin signaling pathway
bom04922  Glucagon signaling pathway
bom04924  Renin secretion
bom04925  Aldosterone synthesis and secretion
bom04970  Salivary secretion
bom04971  Gastric acid secretion
bom05010  Alzheimer disease
bom05012  Parkinson disease
bom05022  Pathways of neurodegeneration - multiple diseases
bom05031  Amphetamine addiction
bom05034  Alcoholism
bom05133  Pertussis
bom05152  Tuberculosis
bom05163  Human cytomegalovirus infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05170  Human immunodeficiency virus 1 infection
bom05200  Pathways in cancer
bom05214  Glioma
bom05417  Lipid and atherosclerosis
bom05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    102266295
   04015 Rap1 signaling pathway
    102266295
   04371 Apelin signaling pathway
    102266295
   04020 Calcium signaling pathway
    102266295
   04070 Phosphatidylinositol signaling system
    102266295
   04024 cAMP signaling pathway
    102266295
   04022 cGMP-PKG signaling pathway
    102266295
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102266295
   04218 Cellular senescence
    102266295
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102266295
  09152 Endocrine system
   04910 Insulin signaling pathway
    102266295
   04922 Glucagon signaling pathway
    102266295
   04912 GnRH signaling pathway
    102266295
   04915 Estrogen signaling pathway
    102266295
   04921 Oxytocin signaling pathway
    102266295
   04916 Melanogenesis
    102266295
   04924 Renin secretion
    102266295
   04925 Aldosterone synthesis and secretion
    102266295
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102266295
   04270 Vascular smooth muscle contraction
    102266295
  09154 Digestive system
   04970 Salivary secretion
    102266295
   04971 Gastric acid secretion
    102266295
  09156 Nervous system
   04728 Dopaminergic synapse
    102266295
   04720 Long-term potentiation
    102266295
   04722 Neurotrophin signaling pathway
    102266295
  09157 Sensory system
   04744 Phototransduction
    102266295
   04740 Olfactory transduction
    102266295
   04750 Inflammatory mediator regulation of TRP channels
    102266295
  09159 Environmental adaptation
   04713 Circadian entrainment
    102266295
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102266295
  09162 Cancer: specific types
   05214 Glioma
    102266295
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102266295
   05163 Human cytomegalovirus infection
    102266295
   05167 Kaposi sarcoma-associated herpesvirus infection
    102266295
  09171 Infectious disease: bacterial
   05133 Pertussis
    102266295
   05152 Tuberculosis
    102266295
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102266295
   05012 Parkinson disease
    102266295
   05022 Pathways of neurodegeneration - multiple diseases
    102266295
  09165 Substance dependence
   05031 Amphetamine addiction
    102266295
   05034 Alcoholism
    102266295
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    102266295
   05418 Fluid shear stress and atherosclerosis
    102266295
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bom01009]
    102266295
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bom04131]
    102266295
   03036 Chromosome and associated proteins [BR:bom03036]
    102266295
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bom04147]
    102266295
Protein phosphatases and associated proteins [BR:bom01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     102266295
Membrane trafficking [BR:bom04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    102266295
Chromosome and associated proteins [BR:bom03036]
 Eukaryotic type
  Centrosome formation proteins
   Centrosome duplication proteins
    Centriole replication proteins
     102266295
Exosome [BR:bom04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   102266295
SSDB
Motif
Pfam: EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 AIF-1 EF-hand_FSTL1 EF-hand_9 EH SPARC_Ca_bdg DUF5580_M EF-hand_STIM1 SAPC2_N EF-hand_EFHB_C EF_EFCAB10_C EF-hand_11 FCaBP_EF-hand CFAP251_C DUF8698 UPF0154 EF-hand_14 SurA_N_3 TerB Phage_TAC_12 Dockerin_1 SPEF2_C NNH6 SurA_N_2 RSA-1_C ExbD YolB BamM_C
Other DBs
NCBI-GeneID: 102266295
NCBI-ProteinID: XP_005901023
UniProt: L8I8W7
LinkDB
Position
13:28023750..28024196
AA seq 148 aa
MAEKLSEEQVAEFKEAFDRFDKNKDGTISVQELGTVMQEVGLKLSEAELKKLISQLDTDK
NGSISFQEFLEAMAAGLQTSDTEGLREIFRAFDQDDDGYISVDELRQATSQLGEKVSQDE
LDAMIREADVDQDGRVNYEEFVRILTQN
NT seq 447 nt   +upstreamnt  +downstreamnt
atggcagaaaagctgtccgaagagcaggtggcggagttcaaggaggcctttgacaggttc
gacaagaacaaggatggcaccatcagtgtgcaggagctgggcactgtgatgcaggaggtg
ggcctgaagctgtcagaggctgagctgaagaagctcatctcccagctggacacggacaag
aacggcagcatcagcttccaggagttcctggaggccatggccgcagggcttcagacctca
gacacggagggactgagggaaatcttccgtgccttcgaccaggacgacgatggctacatc
agcgtggacgagctcaggcaggccacgtcccagctgggggagaaggtgtctcaggatgag
ctggacgccatgatccgggaggcggacgtggaccaagacggccgggtgaactatgaggaa
ttcgtgcgcatcctcacccagaactga

DBGET integrated database retrieval system