Bos mutus (wild yak): 102266700 Help Entry 102266700         CDS       T02919                                  Symbol GNG7 Name (RefSeq) G protein subunit gamma 7   KO K04543   guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7 Organism bom  Bos mutus (wild yak) Pathway bom04014   Ras signaling pathway bom04062   Chemokine signaling pathway bom04151   PI3K-Akt signaling pathway bom04371   Apelin signaling pathway bom04713   Circadian entrainment bom04723   Retrograde endocannabinoid signaling bom04724   Glutamatergic synapse bom04725   Cholinergic synapse bom04726   Serotonergic synapse bom04727   GABAergic synapse bom04728   Dopaminergic synapse bom04740   Olfactory transduction bom04926   Relaxin signaling pathway bom05032   Morphine addiction bom05034   Alcoholism bom05163   Human cytomegalovirus infection bom05167   Kaposi sarcoma-associated herpesvirus infection bom05170   Human immunodeficiency virus 1 infection bom05200   Pathways in cancer Brite KEGG Orthology (KO) [BR:bom00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     102266700 (GNG7)    04371 Apelin signaling pathway     102266700 (GNG7)    04151 PI3K-Akt signaling pathway     102266700 (GNG7)  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     102266700 (GNG7)   09152 Endocrine system    04926 Relaxin signaling pathway     102266700 (GNG7)   09156 Nervous system    04724 Glutamatergic synapse     102266700 (GNG7)    04727 GABAergic synapse     102266700 (GNG7)    04725 Cholinergic synapse     102266700 (GNG7)    04728 Dopaminergic synapse     102266700 (GNG7)    04726 Serotonergic synapse     102266700 (GNG7)    04723 Retrograde endocannabinoid signaling     102266700 (GNG7)   09157 Sensory system    04740 Olfactory transduction     102266700 (GNG7)   09159 Environmental adaptation    04713 Circadian entrainment     102266700 (GNG7)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102266700 (GNG7)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102266700 (GNG7)    05163 Human cytomegalovirus infection     102266700 (GNG7)    05167 Kaposi sarcoma-associated herpesvirus infection     102266700 (GNG7)   09165 Substance dependence    05032 Morphine addiction     102266700 (GNG7)    05034 Alcoholism     102266700 (GNG7)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bom04147]     102266700 (GNG7)    04031 GTP-binding proteins [BR:bom04031]     102266700 (GNG7) Exosome [BR:bom04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102266700 (GNG7)   Exosomal proteins of other body fluids (saliva and urine)    102266700 (GNG7) GTP-binding proteins [BR:bom04031]  Heterotrimeric G-proteins   Gamma Subunits    Gamma [OT]     102266700 (GNG7) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  G-gamma FtsX_ECD CP12 Motif Other DBs NCBI-GeneID:  102266700 NCBI-ProteinID:  XP_005888403 UniProt:  L8J0M7 LinkDB All DBs Position Un AA seq 68 aa AA seqDB search MSATNNIAQARKLVEQLRIEAGIERIKVSKASSELMSYCEQHARNDPLLVGVPASENPFK DKKPCIIL NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atgtcagccactaacaacatagcccaggctcggaagctggtggagcagctccgcatcgaa gctgggatcgagcgcattaaggtctccaaagcctcctccgaactcatgagctactgtgag cagcacgcccggaacgaccccctgctggtgggagtccccgcctccgagaacccctttaag gacaagaagccttgtattatcctatag

DBGET integrated database retrieval system