Bos mutus (wild yak): 102266974 Help Entry 102266974         CDS       T02919                                  Symbol UBB Name (RefSeq) ubiquitin B   KO K04551   ubiquitin B Organism bom  Bos mutus (wild yak) Pathway bom04120   Ubiquitin mediated proteolysis bom04137   Mitophagy - animal bom04140   Autophagy - animal bom05012   Parkinson disease bom05022   Pathways of neurodegeneration - multiple diseases bom05167   Kaposi sarcoma-associated herpesvirus infection Brite KEGG Orthology (KO) [BR:bom00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     102266974 (UBB)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     102266974 (UBB)    04137 Mitophagy - animal     102266974 (UBB)  09160 Human Diseases   09172 Infectious disease: viral    05167 Kaposi sarcoma-associated herpesvirus infection     102266974 (UBB)   09164 Neurodegenerative disease    05012 Parkinson disease     102266974 (UBB)    05022 Pathways of neurodegeneration - multiple diseases     102266974 (UBB)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:bom04121]     102266974 (UBB)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bom04147]     102266974 (UBB) Ubiquitin system [BR:bom04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    102266974 (UBB) Exosome [BR:bom04147]  Exosomal proteins   Exosomal proteins of breast milk    102266974 (UBB)   Exosomal proteins of other body fluids (saliva and urine)    102266974 (UBB)   Exosomal proteins of colorectal cancer cells    102266974 (UBB)   Exosomal proteins of bladder cancer cells    102266974 (UBB) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Ubiquitin_2 DUF2604 Rad60-SLD_2 TBK1_ULD Ubiquitin_5 OTU1_UBXL Dsc3_N Sde2_N_Ubi HATPase_c Motif Other DBs NCBI-GeneID:  102266974 NCBI-ProteinID:  XP_005887317 LinkDB All DBs Position Un AA seq 153 aa AA seqDB search MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLI FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGC NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atgcagatcttcgtgaaaaccctgaccggcaagaccatcaccctggaggtggagcccagt gacaccatcgagaacgtgaaggccaagatccaggataaggagggcattccccccgaccag cagaggctcatctttgccggcaagcagctggaagatggccgcactctttctgattacaac atccagaaagagtcgaccctgcacctggtcctccgtctgaggggtggtatgcagatcttc gtgaagaccctgaccggcaagaccatcaccctggaagtggagcccagtgacaccatcgag aacgtgaaggccaagatccaggataaggaaggcattccccctgaccagcagaggctcatc tttgccggcaagcagctggaagatggccgcactctttctgattacaacatccagaaagag tcgaccctgcacctggtccttcgtctgaggggtggctgttaa

DBGET integrated database retrieval system