Bos mutus (wild yak): 102267084 Help Entry 102267084         CDS       T02919                                  Symbol ELOC Name (RefSeq) elongin-C   KO K03872   elongin-C Organism bom  Bos mutus (wild yak) Pathway bom04066   HIF-1 signaling pathway bom04120   Ubiquitin mediated proteolysis bom05170   Human immunodeficiency virus 1 infection bom05200   Pathways in cancer bom05211   Renal cell carcinoma Brite KEGG Orthology (KO) [BR:bom00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     102267084 (ELOC)  09130 Environmental Information Processing   09132 Signal transduction    04066 HIF-1 signaling pathway     102267084 (ELOC)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102267084 (ELOC)   09162 Cancer: specific types    05211 Renal cell carcinoma     102267084 (ELOC)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102267084 (ELOC)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:bom04121]     102267084 (ELOC)    03400 DNA repair and recombination proteins [BR:bom03400]     102267084 (ELOC) Ubiquitin system [BR:bom04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      102267084 (ELOC)    Cul5 complex      102267084 (ELOC) DNA repair and recombination proteins [BR:bom03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      102267084 (ELOC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1_POZ Motif Other DBs NCBI-GeneID:  102267084 NCBI-ProteinID:  XP_005907573 UniProt:  A0A6B0QT37 LinkDB All DBs Position 14:44854362..44873317 Genome browser AA seq 112 aa AA seqDB search MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEV NFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC NT seq 339 nt NT seq  +upstreamnt  +downstreamnt atggatggagaagagaaaacctatggtggctgtgagggccctgatgccatgtatgtcaaa ttgatatcttcagatggtcatgagtttattgtaaagagagaacatgcgctaacatcagga acaataaaagccatgttgagtggcccaggtcagtttgcggagaatgaaactaatgaagtc aattttagagagatcccttcacatgtgctatcgaaagtatgcatgtattttacctacaag gttcgctacactaacagctccacggagattcctgaattcccaattgcacctgaaattgca ctggaactgctgatggctgcgaacttcctagattgttaa

DBGET integrated database retrieval system