Bos mutus (wild yak): 102267614 Help Entry 102267614         CDS       T02919                                  Symbol HMGB1 Name (RefSeq) high mobility group box 1   KO K10802   high mobility group protein B1 Organism bom  Bos mutus (wild yak) Pathway bom03410   Base excision repair bom04140   Autophagy - animal bom04217   Necroptosis bom04613   Neutrophil extracellular trap formation Brite KEGG Orthology (KO) [BR:bom00001]  09120 Genetic Information Processing   09124 Replication and repair    03410 Base excision repair     102267614 (HMGB1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     102267614 (HMGB1)   09143 Cell growth and death    04217 Necroptosis     102267614 (HMGB1)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     102267614 (HMGB1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bom03036]     102267614 (HMGB1)    03400 DNA repair and recombination proteins [BR:bom03400]     102267614 (HMGB1)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bom04147]     102267614 (HMGB1) Chromosome and associated proteins [BR:bom03036]  Eukaryotic type   Nucleosome assembly factors    HMG (high mobility group) proteins     102267614 (HMGB1) DNA repair and recombination proteins [BR:bom03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Other BER factors      102267614 (HMGB1)    MMR (mismatch excision repair)     Other MMR factors      102267614 (HMGB1) Exosome [BR:bom04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    102267614 (HMGB1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  HMG_box_2 HMG_box NOA36 HMG_box_5 Nop14 Motif Other DBs NCBI-GeneID:  102267614 NCBI-ProteinID:  XP_005902225 LinkDB All DBs Position Un AA seq 215 aa AA seqDB search MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKF EDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGL SIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEK SKKKKEEEEDEEDEEDEEEEEDEEDEEEEEDDDDE NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atgggcaaaggagatcctaagaagccgagaggcaaaatgtcatcatatgcattctttgtg caaacttgccgggaggagcacaagaagaagcacccggatgcttctgtcaacttctcagag ttttctaagaagtgctcagagaggtggaagaccatgtctgctaaagagaaaggaaaattt gaagacatggcaaaggcggacaaggcccgttatgaaagagaaatgaaaacttatattcct cctaaaggggaaacaaaaaagaagttcaaggatcccaatgcacctaagaggcctccttcg gcctttttcttgttttgttctgagtatcgtccaaaaatcaaaggcgaacatcctggcctg tctattggtgatgttgcaaagaaactgggagagatgtggaataacactgctgcggatgat aagcagccttatgagaagaaggctgctaagctgaaggaaaagtatgaaaaggatattgcc gcataccgagctaaagggaagcctgatgcagcaaaaaagggagttgtcaaggctgaaaag agcaagaaaaagaaggaagaggaggaagatgaggaagatgaagaggatgaggaggaggaa gaagatgaagaggatgaggaggaggaagaagatgatgatgatgagtaa

DBGET integrated database retrieval system