Bos mutus (wild yak): 102267762 Help Entry 102267762         CDS       T02919                                  Name (RefSeq) interferon alpha-G   KO K05414   interferon alpha Organism bom  Bos mutus (wild yak) Pathway bom04060   Cytokine-cytokine receptor interaction bom04151   PI3K-Akt signaling pathway bom04217   Necroptosis bom04620   Toll-like receptor signaling pathway bom04621   NOD-like receptor signaling pathway bom04622   RIG-I-like receptor signaling pathway bom04623   Cytosolic DNA-sensing pathway bom04630   JAK-STAT signaling pathway bom04650   Natural killer cell mediated cytotoxicity bom04936   Alcoholic liver disease bom05152   Tuberculosis bom05160   Hepatitis C bom05161   Hepatitis B bom05162   Measles bom05163   Human cytomegalovirus infection bom05164   Influenza A bom05165   Human papillomavirus infection bom05167   Kaposi sarcoma-associated herpesvirus infection bom05168   Herpes simplex virus 1 infection bom05169   Epstein-Barr virus infection bom05170   Human immunodeficiency virus 1 infection bom05171   Coronavirus disease - COVID-19 bom05200   Pathways in cancer bom05320   Autoimmune thyroid disease bom05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:bom00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     102267762    04151 PI3K-Akt signaling pathway     102267762   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102267762  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     102267762  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     102267762    04621 NOD-like receptor signaling pathway     102267762    04622 RIG-I-like receptor signaling pathway     102267762    04623 Cytosolic DNA-sensing pathway     102267762    04650 Natural killer cell mediated cytotoxicity     102267762  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102267762   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102267762    05161 Hepatitis B     102267762    05160 Hepatitis C     102267762    05171 Coronavirus disease - COVID-19     102267762    05164 Influenza A     102267762    05162 Measles     102267762    05168 Herpes simplex virus 1 infection     102267762    05163 Human cytomegalovirus infection     102267762    05167 Kaposi sarcoma-associated herpesvirus infection     102267762    05169 Epstein-Barr virus infection     102267762    05165 Human papillomavirus infection     102267762   09171 Infectious disease: bacterial    05152 Tuberculosis     102267762   09163 Immune disease    05320 Autoimmune thyroid disease     102267762   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102267762   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     102267762  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bom04052]     102267762 Cytokines and neuropeptides [BR:bom04052]  Cytokines   Interferons    102267762 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon pAdhesive_17 Motif Other DBs NCBI-GeneID:  102267762 NCBI-ProteinID:  XP_070223033 LinkDB All DBs Position Unknown AA seq 189 aa AA seqDB search MAPAWSFLLALLLLSCNAICSLGCHLPHTHSLANRRVLMLLQQLRRVSPSSCLQDRNDFA FPQEALGGSQLQKAQAISVLHEVTQHTFQLFSTEGSAITWDESLLDKLRTALDQQLTDLQ FCLRQEEGLRGAPLLKEDSSLAVRKYFHRLTLYLQEKRHSPCAWEVVRAEVMRAFSSSTN LQERFRRKD NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atggccccagcctggtccttcctcctggccctgctgctgctcagctgcaacgccatctgc tctctgggctgccacctgcctcacacccacagcctggccaacaggagggtcctgatgctc ctgcaacaactgaggagggtctccccttcctcctgcctgcaggacagaaatgacttcgca ttcccccaggaggcgctgggtggcagccagttgcagaaggctcaagccatctctgtgctc cacgaggtgacccagcacaccttccagctcttcagcacagagggctcggccatcacgtgg gacgagagcctcctggacaagctccgcactgcactggatcagcagctcactgacctgcaa ttctgtctgaggcaggaggaggggctgcgaggggctcccctgctcaaggaggactccagc ctggctgtgaggaaatacttccacagactcactctctatctgcaagagaagagacacagc ccttgtgcctgggaggttgtcagagcagaagtcatgagagccttctcttcctcaacaaac ttgcaggagagattcaggagaaaggactga

DBGET integrated database retrieval system