Bos mutus (wild yak): 102268783 Help Entry 102268783         CDS       T02919                                  Name (RefSeq) histone H4-like   KO K11254   histone H4 Organism bom  Bos mutus (wild yak) Pathway bom04613   Neutrophil extracellular trap formation bom05034   Alcoholism bom05203   Viral carcinogenesis bom05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:bom00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     102268783  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     102268783   09163 Immune disease    05322 Systemic lupus erythematosus     102268783   09165 Substance dependence    05034 Alcoholism     102268783  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bom03036]     102268783 Chromosome and associated proteins [BR:bom03036]  Eukaryotic type   Nucleosome assembly factors    Histones     102268783 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  HIGH_NTase1_ass CENP-T_C Motif Other DBs NCBI-GeneID:  102268783 NCBI-ProteinID:  XP_005890484 LinkDB All DBs Position Un AA seq 99 aa AA seqDB search MSGRGKSSKGLGKGGTKRHHKVLHDNIQGITKPAIRRLAHRGGVKRISGLIYEETREVLK VFLENVIWDVGTYTKHAQLRAGIREVPCMQVASLNLSSV NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgtctggacgtggcaaaagcagcaagggtctggggaaaggcggcactaagcgccaccac aaggttctacacgacaacatccagggcatcactaaacctgctatccgccgcctggctcat cgtggtggtgtgaagcgcatctctgggctcatctacgaagagacccgcgaggtcctgaaa gtgtttctggagaacgtgatctgggacgtgggcacctacaccaagcatgcccaactgaga gctggcatcagggaagtgccctgcatgcaggtggcttcgttgaacttgagttctgtatga

DBGET integrated database retrieval system