Bos mutus (wild yak): 102268935 Help Entry 102268935         CDS       T02919                                  Name (RefSeq) histone H4   KO K11254   histone H4 Organism bom  Bos mutus (wild yak) Pathway bom04613   Neutrophil extracellular trap formation bom05034   Alcoholism bom05203   Viral carcinogenesis bom05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:bom00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     102268935  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     102268935   09163 Immune disease    05322 Systemic lupus erythematosus     102268935   09165 Substance dependence    05034 Alcoholism     102268935  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bom03036]     102268935 Chromosome and associated proteins [BR:bom03036]  Eukaryotic type   Nucleosome assembly factors    Histones     102268935 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-T_C CENP-S TAF Histone CBFD_NFYB_HMF TFIID-31kDa Bromo_TP TFIID_20kDa UPF0137 Motif Other DBs NCBI-GeneID:  102268935 NCBI-ProteinID:  XP_005907808 UniProt:  L8HXY8 LinkDB All DBs Position 9:complement(4038521..4038849) Genome browser AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIQRLARRGGVKHISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYVLKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtctggtcgtgggaagggtggcaaaggcctgggcaaggggggtgctaagcgccatcgc aaagtcttgcgggacaacattcagggtattactaagccagctatccagcgtctggctcgt cgtggaggcgtcaaacatatttctggtcttatctacgaagagactcgtggggtgctgaaa gtgtttctggaaaatgtgatccgggacgcggtcacctatacggagcacgctaagcgcaag actgttaccgccatggatgtggtctacgtgctcaaacgtcagggccgtaccctttacggt tttggtggttga

DBGET integrated database retrieval system