Bos mutus (wild yak): 102269030 Help Entry 102269030         CDS       T02919                                  Symbol PFN2 Name (RefSeq) profilin-2 isoform X1   KO K05759   profilin Organism bom  Bos mutus (wild yak) Pathway bom04015   Rap1 signaling pathway bom04810   Regulation of actin cytoskeleton bom05014   Amyotrophic lateral sclerosis bom05132   Salmonella infection Brite KEGG Orthology (KO) [BR:bom00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     102269030 (PFN2)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     102269030 (PFN2)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102269030 (PFN2)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     102269030 (PFN2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bom04131]     102269030 (PFN2)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:bom04812]     102269030 (PFN2)    04147 Exosome [BR:bom04147]     102269030 (PFN2) Membrane trafficking [BR:bom04131]  Others   Actin-binding proteins    Others     102269030 (PFN2) Cytoskeleton proteins [BR:bom04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      102269030 (PFN2) Exosome [BR:bom04147]  Exosomal proteins   Proteins found in most exosomes    102269030 (PFN2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  102269030 NCBI-ProteinID:  XP_070230883 LinkDB All DBs Position 1:117087958..117095367 Genome browser AA seq 140 aa AA seqDB search MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPVEIDMIVGKDREGFF TNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVH GGGLNKKAYSMAKYLRDSGF NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccggttggcagagctacgtggataacctgatgtgcgatggctgctgccaggaggcc gccattgtcggctactgcgacgccaaatacgtctgggcagccacggccgggggcgtcttc cagagcattacgccagtagaaatagatatgattgtaggaaaagaccgggaaggtttcttt accaatggtttgactcttggcgcaaagaagtgctcagtgatcagagatagcctatacgtg gacggtgactgcacaatggacatccggacaaagagtcaaggtggggagccaacgtacaac gtggccgtgggcagagctggtagagtcttggtctttgtaatgggaaaagaaggggtccat ggaggcggattgaataagaaggcatactcaatggcaaaatacttgagagactctgggttc tag

DBGET integrated database retrieval system