KEGG   Bos mutus (wild yak): 102270228
Entry
102270228         CDS       T02919                                 
Symbol
ITGAX
Name
(RefSeq) integrin subunit alpha X
  KO
K06462  integrin alpha X
Organism
bom  Bos mutus (wild yak)
Pathway
bom04610  Complement and coagulation cascades
bom04810  Regulation of actin cytoskeleton
bom05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:bom00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102270228 (ITGAX)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    102270228 (ITGAX)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102270228 (ITGAX)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:bom04515]
    102270228 (ITGAX)
   04090 CD molecules [BR:bom04090]
    102270228 (ITGAX)
Cell adhesion molecules [BR:bom04515]
 Integrins
  Integrin alpha subunits
   102270228 (ITGAX)
CD molecules [BR:bom04090]
 Proteins
  102270228 (ITGAX)
SSDB
Motif
Pfam: Integrin_alpha2 VWA FG-GAP VWA_2 Integrin_alpha FG-GAP_3
Other DBs
NCBI-GeneID: 102270228
NCBI-ProteinID: XP_005887028
LinkDB
Position
Un
AA seq 1156 aa
MTRTRVFLLLLMAPVSSLCFNLDTEQPTTFRVDSPGFGHSVVQYAQWLVVGAPREVKAAN
QTGGLYSCDYGTGKCEAIPLQVPPEAVNMSLGLSMAATTNPFQLLACGPTVHHACRENMH
LTGTCFLLASPFRQVKRIPAALQECPRQDQDIAFLIDGSGSIFSSDFNKMLNFVKAVMSQ
FQRPNSQFSLVQFSSTFKVHFAFKDFATSSDPLSLLNSVRQLRQWTFTASAILFVTDKLF
SAAYGARKDASKILIVITDGEKTENLGYEDVIPRAEAAGIIRYAIGVGSAFRYKKSLKEL
IDIASTPSEEHVFQVENFDALRDIQKQLKEKIFAIEGTQTISSSSFELEMSQEGFSAVFM
PDGPVLGAVGSFSWSGGAFLYPXTPPFINMSQEHVDMRDSYLGYSTELALWRGAQSLILG
APRHQHTGKVVLFTQVSRQWRPQAEVTGTQIGSYFGASLCSVDVNGDSSSDLVLSGAPHF
YEQTQGGQVSVCPFPRGRAKWQCDAVLRGEPGHPWGRFGAALTVLGDVNGDRLVDVAIGA
PGEQENQGAVYLFHGTSELGISPSHSQRVTGAQLSPSLQYFGQSLSGGQDLTQDGLADVA
VGAQGHALLLRTRPVLRMWANIHITPAEIARSVYECQQLVTFPHDLGKAIVCLQVSQSSK
NQLVNLQSIVTFDLTLDPGRLSSRAIFQETGTRNLTRVRELGLKQHCEAVRLLLPDCVED
SVTPIILRLNFSLVGKPISSLRNLQPMLAVDAQRYFTTSLPFEKNCGADHVCQDDLSISF
GVSDLKTLIVGSNLELNLKVRVWNDGEDSYGTAVTFFYPPGLSYRRVTGGQSHLQSRSLR
LTCDSAPAGTQGTRSTRCSVNHLIFREGAQVTFTVTFHVSPTATLGDKLLLAANVSSENN
SPKTSKTAFQLELPVKYAVYTVISSHEQSTKYLNFSASQEEGSREAQHRYQVNNLGQREL
PVSIDISVPMELNQVPVWKDIEVLNPQNPSIQCSSERTAPTESDFLTHFKKKPVLDCSIA
VCLRFRCDIPSFGIQEELDFILKGNLSFRWVSQTQQKKVLVVSVAEITFNRLVYSQLPGQ
ETFLRAQTELVLEKYEVYNPIPLIVGSSLGGLLLLALITALLYKVGFFKRQYKEMMEGAN
QQTVPENETGNPQAAQ
NT seq 3471 nt   +upstreamnt  +downstreamnt
atgaccaggacccgggtttttctcttgctgttgatggccccggtgtcctctctctgcttc
aacttggacacagagcaaccgacaaccttccgtgtggacagccctgggtttggacacagt
gtggtccagtatgcccaatggctggtggttggagccccccgggaggtaaaggctgccaat
caaacaggcggcctctactcgtgtgactacggcacggggaagtgtgaggccatccccctg
caggtgcctccagaggctgtgaacatgtccctgggcctgtccatggcagccaccaccaac
ccctttcaactgctggcctgtggccccaccgtgcaccacgcatgccgggagaacatgcac
ttgaccgggacctgcttcctgctggcctccccgtttcggcaggtcaagaggatcccggct
gccctgcaggagtgcccaaggcaggatcaggacatcgcctttctgatcgacggctcaggc
agcatcttttccagcgattttaacaaaatgttgaacttcgtgaaggccgtgatgagccag
ttccagcgtcccaactcccagttctccctggtgcagttctccagcactttcaaggtgcac
ttcgctttcaaagacttcgctaccagctcagacccactaagcctcctgaattccgtccgg
cagctgcgacaatggacgttcacggcctcagccatcctatttgtcacagataagctgttc
agtgccgcctacggggcccgaaaagatgcctccaaaatcctcatcgtcatcactgatggg
gagaaaacagaaaacctgggttacgaggatgtcattccccgggctgaggccgccggcatc
atccgatatgcaattggggtgggatcagcatttcgatacaaaaagtccttgaaagaatta
atcgacattgcctccacaccctctgaagagcatgtatttcaagtggagaattttgatgct
ttgcgagacattcagaaacaactgaaagagaagatttttgccattgagggtacacagacc
ataagcagtagttccttcgaactggagatgtctcaggagggcttcagtgctgtgttcatg
cctgatggaccagttttgggggctgtggggagcttcagctggtctggaggtgccttcctg
taccccnccaccccccccttcatcaacatgtcccaggagcacgtggacatgagggactcg
tatctgggttactccacagagctggccctttggaggggggcacagagcctgatcctgggg
gcgccccgccatcagcacaccgggaaggtggtcctcttcacccaggtgtccaggcaatgg
aggccgcaggctgaagtcacagggacccagatcggctcctacttcggggcctccctctgc
tccgtggatgtgaatggagatagtagctctgacctggtcctcagcggggcccctcatttc
tacgagcagacccaggggggccaggtgtccgtgtgcccctttccccgggggagagctaag
tggcagtgtgatgctgttctgcgaggggagccgggccacccctggggccgctttggggca
gccctgacagtgctgggggatgtgaatggggacaggctggtggatgtggccattggggcc
ccgggagagcaggagaaccagggtgctgtctacctgttccatggaacctcagaactgggc
atcagcccctcccacagccagcgggtcacaggcgcccagctctcccccagcctccagtat
ttcgggcagtcgctgagcgggggtcaggacctcacccaggatggactggcagacgtggct
gtgggggcccaggggcacgcactgctgctcaggaccagacctgtgctcaggatgtgggcg
aacattcacatcacacctgcagagatcgctaggtctgtctatgagtgtcagcagctggtg
acctttccgcatgatctgggcaaggccattgtctgcctccaagtttcccaaagttccaag
aaccagctggttaacctccaaagcattgtgacctttgacctaacccttgaccccggccgc
ctgagttctcgtgccatcttccaagaaacggggactcggaatctgacccgtgttcgagag
ctggggctgaagcagcactgtgaggctgtgaggttgctccttccggactgtgtggaggac
tcagtgacccccatcatcttgcgtctcaacttctccctggtgggcaagcccatctctagc
ctaagaaacctccagcctatgttggcagtggacgcccagagatacttcacaacctctctc
ccctttgagaagaactgtggcgcggatcacgtctgccaggatgacctcagcatctccttt
ggggtctcagacttgaagaccctgatcgtgggtagtaacctggagctgaacctgaaagtg
agagtgtggaatgatggcgaggactcctatggaaccgcagtcaccttcttctaccctcca
gggttgtcttaccgacgtgtgactgggggccagagccatctgcagtcgcgttctctgcgc
ctgacctgtgacagcgcccccgccgggacccagggcaccagaagcacccgctgtagcgtc
aaccacctcatcttccgtgagggcgcccaggtcaccttcacggtcacctttcacgtctcc
cccacggccaccctgggagacaagctgcttcttgccgccaatgtgagcagtgagaataac
agccccaagacaagcaagaccgccttccagctggagctccccgtgaagtatgccgtctac
accgtgatcagcagccatgaacaatccaccaagtacctcaacttctcggcctcacaggag
gagggcagcagggaggcccagcacagataccaggtgaacaacctggggcagagggagctg
cctgtcagcatcgacatctcagtgcccatggagctgaaccaggtgcccgtgtggaaggac
atagaggtcctcaacccccagaacccctccattcagtgctcttcagagagaacagcgccc
acagagtctgatttcctgacccactttaagaagaagcctgtcctggactgctccatcgct
gtctgcctaaggttccgctgtgacatcccctcctttggcatccaggaggaacttgacttc
atcctgaagggcaacctcagcttccgctgggtcagccagacacagcagaagaaggtgctg
gtcgtgagcgtggctgaaatcaccttcaacagactcgtgtattctcagcttccaggacag
gagacatttttgagagctcagacggagctggtgctggagaagtatgaggtctacaacccc
atccccctcattgtgggcagctctctgggaggactgctgctcctggccctcatcacagcc
ctactgtacaaggttggtttcttcaaacgtcagtacaaggaaatgatggaaggagcaaac
caacagactgtcccagaaaacgagacaggaaacccccaagctgcccaataa

DBGET integrated database retrieval system