Bos mutus (wild yak): 102270543 Help Entry 102270543         CDS       T02919                                  Name (RefSeq) histone H2A-Bbd type 1   KO K11251   histone H2A Organism bom  Bos mutus (wild yak) Pathway bom03082   ATP-dependent chromatin remodeling bom04217   Necroptosis bom04613   Neutrophil extracellular trap formation bom05034   Alcoholism bom05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:bom00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     102270543  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     102270543  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     102270543  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     102270543   09165 Substance dependence    05034 Alcoholism     102270543  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bom03036]     102270543   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bom04147]     102270543 Chromosome and associated proteins [BR:bom03036]  Eukaryotic type   Nucleosome assembly factors    Histones     102270543 Exosome [BR:bom04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102270543 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  102270543 NCBI-ProteinID:  XP_005889501 UniProt:  L8IY69 LinkDB All DBs Position Un AA seq 117 aa AA seqDB search MSPRRHLWNCRRSRRHSLSRSTRAELQFPVSRVDRLLREGQGAYRLSSATPVFLTAVLEY LIANILDLAGKEACTNHRVRISPEHVEMALINNENLRRLFQPGAFSQPAASPHLPEK NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atgtctccaagaagacatctctggaactgccgtcgcagtaggagacactccctctcccgt tccaccagggccgagctgcagttccctgtgagccgcgtggaccgcctcctgagagagggt cagggcgcctatcgcctaagctcagcgacgcctgtgttcctgaccgcagtccttgagtac ctgatagccaacatcctggacctggcggggaaggaggcctgcaccaaccatagggtgcgc atcagcccagagcacgtggagatggcgctgatcaacaatgagaatctccgccgcctcttc cagcccggtgccttctctcagcccgcagcttcaccacaccttcccgagaagtag

DBGET integrated database retrieval system