Bos mutus (wild yak): 102270896 Help Entry 102270896         CDS       T02919                                  Symbol PFN3 Name (RefSeq) profilin-3   KO K05759   profilin Organism bom  Bos mutus (wild yak) Pathway bom04015   Rap1 signaling pathway bom04810   Regulation of actin cytoskeleton bom05014   Amyotrophic lateral sclerosis bom05132   Salmonella infection Brite KEGG Orthology (KO) [BR:bom00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     102270896 (PFN3)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     102270896 (PFN3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102270896 (PFN3)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     102270896 (PFN3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bom04131]     102270896 (PFN3)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:bom04812]     102270896 (PFN3)    04147 Exosome [BR:bom04147]     102270896 (PFN3) Membrane trafficking [BR:bom04131]  Others   Actin-binding proteins    Others     102270896 (PFN3) Cytoskeleton proteins [BR:bom04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      102270896 (PFN3) Exosome [BR:bom04147]  Exosomal proteins   Proteins found in most exosomes    102270896 (PFN3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Terminase-T7_RNaseH-like Motif Other DBs NCBI-GeneID:  102270896 NCBI-ProteinID:  XP_070230950 LinkDB All DBs Position 7:complement(78787641..78789469) Genome browser AA seq 137 aa AA seqDB search MGDWKGYISAVLRDQRIDDVAIVGHSDNRCVWASRPGGLLAAISPQEVGVLTGPDRSTFL QAGLCVAGRRCCVIRDHLLAEGDGVLDARTKGLDGRAICVGHTPRALLVLMGRRGVHGGI LNKTMHELIHGLRSQGT NT seq 414 nt NT seq  +upstreamnt  +downstreamnt atgggcgactggaaaggttacatcagtgcagtgcttcgggaccagcgcatcgacgacgtg gccattgtgggccactcggacaatcgctgcgtgtgggcctcgaggcctgggggcctgctg gcggccatctcaccgcaggaggtgggtgtgctcaccgggccagaccggagcaccttcctg caggccgggctgtgcgtggcgggccgccgttgctgcgtcatccgagaccacctgctggcg gagggtgacggagtgctggacgcacgcaccaagggtctggacgggcgcgccatctgcgtg ggccacacgcctcgggcgcttctcgtgctcatgggccggcggggtgtgcatgggggcatt ctcaacaagacgatgcacgagctgatccatgggctgcgctcgcagggcacctag

DBGET integrated database retrieval system