Bos mutus (wild yak): 102270937 Help Entry 102270937         CDS       T02919                                  Symbol CYBA Name (RefSeq) cytochrome b-245 light chain   KO K08009   cytochrome b-245, alpha polypeptide Organism bom  Bos mutus (wild yak) Pathway bom04145   Phagosome bom04380   Osteoclast differentiation bom04613   Neutrophil extracellular trap formation bom04621   NOD-like receptor signaling pathway bom04670   Leukocyte transendothelial migration bom05020   Prion disease bom05140   Leishmaniasis bom05208   Chemical carcinogenesis - reactive oxygen species bom05415   Diabetic cardiomyopathy bom05417   Lipid and atherosclerosis bom05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:bom00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     102270937 (CYBA)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     102270937 (CYBA)    04621 NOD-like receptor signaling pathway     102270937 (CYBA)    04670 Leukocyte transendothelial migration     102270937 (CYBA)   09158 Development and regeneration    04380 Osteoclast differentiation     102270937 (CYBA)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     102270937 (CYBA)   09174 Infectious disease: parasitic    05140 Leishmaniasis     102270937 (CYBA)   09164 Neurodegenerative disease    05020 Prion disease     102270937 (CYBA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102270937 (CYBA)    05418 Fluid shear stress and atherosclerosis     102270937 (CYBA)    05415 Diabetic cardiomyopathy     102270937 (CYBA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bom04131]     102270937 (CYBA) Membrane trafficking [BR:bom04131]  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     102270937 (CYBA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cytochrom_B558a Cg6151-P DUF6030 COPI_assoc Motif Other DBs NCBI-GeneID:  102270937 NCBI-ProteinID:  XP_005892470 LinkDB All DBs Position 18:48750903..48758027 Genome browser AA seq 191 aa AA seqDB search MGQIEWAMWANEQALASGLILITGGIVATAGQFTQWYLGAYSIAAGVLVCLLEYPRGKRS KGSTMERCGQKYLTRVVKLFGPLTRNYYIRAFLHLGLAVPAGFLLATILGTACLAIASGI YLLAAIRGEQWSPIEPKPKERPQIGGTIKQPPSNPPPRPPAEARKKPSEEAAGVPTGGPQ ENPMPVNDEVV NT seq 576 nt NT seq  +upstreamnt  +downstreamnt atggggcagatcgagtgggccatgtgggccaacgagcaggcgctggcgtccggtctgatc cttatcaccgggggcatcgtggccacggccggtcagttcacccagtggtacctgggcgcc tactccatagcagcaggcgtattggtctgcctgctggaataccctcgagggaagaggagc aagggctccaccatggagaggtgtggacagaagtacctgaccagagtggtgaagctgttt gggcccctcaccaggaactactacatccgggccttcttgcacctcgggctggcggtacct gctggcttcctgctcgccaccatcctggggacagcctgcttggccatcgcaagcggcatc tatctgctggcagccatccgtggggagcagtggagccccattgagcccaagcccaaggag cggccgcagattgggggcaccatcaagcagccgcccagcaaccctccaccccggcccccg gctgaggcccgcaagaagccgagtgaggaggcggcgggggtccccacgggtggcccccag gaaaaccccatgccagtgaatgacgaggtcgtgtga

DBGET integrated database retrieval system