Bos mutus (wild yak): 102271338 Help Entry 102271338         CDS       T02919                                  Symbol CENPS Name (RefSeq) centromere protein S   KO K11511   centromere protein S Organism bom  Bos mutus (wild yak) Pathway bom03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:bom00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     102271338 (CENPS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bom03036]     102271338 (CENPS)    03400 DNA repair and recombination proteins [BR:bom03400]     102271338 (CENPS) Chromosome and associated proteins [BR:bom03036]  Eukaryotic type   Centromeric chromatin formation proteins    Kinetochore proteins     Centromere proteins      102271338 (CENPS) DNA repair and recombination proteins [BR:bom03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      102271338 (CENPS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-S CENP-T_C Histone COMMD1_N TFIID-18kDa Motif Other DBs NCBI-GeneID:  102271338 NCBI-ProteinID:  XP_005892781 LinkDB All DBs Position 16:42931877..42946636 Genome browser AA seq 139 aa AA seqDB search MMEEEEWSEEQQRFSYLQRLKAAVHYTVGCLCEEVASDKDMQFSKQTIAAISEVTFGQCE NFAKDLEMFARHAKRSTINTEDVKLLARRSHSLLKYITEKNEDIAQLNLEKKAKKKKKLE DENRNSVESAEAGVEESEN NT seq 420 nt NT seq  +upstreamnt  +downstreamnt atgatggaggaggaggagtggtccgaggagcagcaacgcttctcttacctacagaggcta aaggcagcggttcactacacggttggttgtctttgcgaggaagttgcgtcggacaaagac atgcagttcagcaagcaaaccattgcagcgatctcagaggtgacctttggacagtgtgaa aattttgccaaagaccttgaaatgtttgcaagacatgcgaaaagaagcacaattaacact gaagacgtgaagctcttagccaggaggagtcattcactgctaaaatacatcacagagaaa aatgaagacatcgctcagcttaacctggaaaaaaaagcaaagaagaagaagaagttggag gatgaaaacagaaattcagtggagtcagcagaggctggtgtagaagaaagtgagaattaa

DBGET integrated database retrieval system