Bos mutus (wild yak): 102271512 Help Entry 102271512         CDS       T02919                                  Symbol CLDN34 Name (RefSeq) claudin 34   KO K06087   claudin Organism bom  Bos mutus (wild yak) Pathway bom03272   Virion - Hepatitis viruses bom04514   Cell adhesion molecules bom04530   Tight junction bom04670   Leukocyte transendothelial migration bom05160   Hepatitis C Brite KEGG Orthology (KO) [BR:bom00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     102271512 (CLDN34)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     102271512 (CLDN34)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     102271512 (CLDN34)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     102271512 (CLDN34)  09160 Human Diseases   09172 Infectious disease: viral    05160 Hepatitis C     102271512 (CLDN34)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:bom03037]     102271512 (CLDN34)    04147 Exosome [BR:bom04147]     102271512 (CLDN34) Cilium and associated proteins [BR:bom03037]  Other cilia and associated proteins   Stereociliary proteins    102271512 (CLDN34) Exosome [BR:bom04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    102271512 (CLDN34)   Exosomal proteins of colorectal cancer cells    102271512 (CLDN34) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Claudin_2 Motif Other DBs NCBI-GeneID:  102271512 NCBI-ProteinID:  XP_005911708 LinkDB All DBs Position Un AA seq 190 aa AA seqDB search MSLLINSANCQIVGFAVATIGWILGTTAMGFVEWRVWYLDNASQFSGLACMGMWRVCVFR QTNITTATSCHSYSYHDTYLPLDIRVSQHLLLMASILGLLGKASVTFALKNVSMGILENT TTYKAFVISGILHIAAGICISVAVIWNYHSVMTEEGIVFPPSFNIPFKPYAQKIGNTVIV ACLAAFALFL NT seq 571 nt NT seq  +upstreamnt  +downstreamnt atgtccttgctcatcaacagcgccaattgccaaatagtaggttttgcagtagccactatt ggatggatcctcggcaccactgccatgggcttcgtggagtggcgagtatggtatctagac aacgcctcacaattctctggtctggcctgcatgggaatgtggagagtctgtgtcttccgt caaaccaacatcaccacagctacctcatgtcacagttacagctaccatgatacttaccta cctcttgatatccgtgtttctcaacacctcttactgatggccagcattctaggactcttg gggaaagcctctgttacttttgcacttaaaaatgtgtccatgggaattcttgagaatact actacctacaaagcatttgtcatttcaggaattctccacatagctgctggtatctgtatc tcagttgctgtcatctggaattaccactctgtgatgactgaagagggcattgtcttccca ccatctttcaatatacccttcaagccatatgctcagaaaattggcaacactgttatagtg gcatgtctagctgcctttgcgctgttcttag

DBGET integrated database retrieval system