Bos mutus (wild yak): 102271711 Help Entry 102271711         CDS       T02919                                  Symbol GHRL Name (RefSeq) appetite-regulating hormone   KO K05254   ghrelin Organism bom  Bos mutus (wild yak) Pathway bom04024   cAMP signaling pathway bom04080   Neuroactive ligand-receptor interaction bom04081   Hormone signaling bom04935   Growth hormone synthesis, secretion and action Brite KEGG Orthology (KO) [BR:bom00001]  09130 Environmental Information Processing   09132 Signal transduction    04024 cAMP signaling pathway     102271711 (GHRL)   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     102271711 (GHRL)    04081 Hormone signaling     102271711 (GHRL)  09150 Organismal Systems   09152 Endocrine system    04935 Growth hormone synthesis, secretion and action     102271711 (GHRL)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bom04052]     102271711 (GHRL) Cytokines and neuropeptides [BR:bom04052]  Neuropeptides   GPCR binding    102271711 (GHRL) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Motilin_assoc Motilin_ghrelin Motif Other DBs NCBI-GeneID:  102271711 NCBI-ProteinID:  XP_005896172 LinkDB All DBs Position 22:complement(54450974..54454977) Genome browser AA seq 116 aa AA seqDB search MPALWTICSLLLLSVLCMDLAMAGSSFLSPEHQKLQRKEPKKPSGRLKPRALEGQFDPEV GSQAEGAEDELEIRFNAPFNVGIKLSGAQSLQHGQTLGKFLQDILWEEAEETLADE NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atgcccgccctgtggaccatctgcagcctgctgctgctcagcgtgctctgcatggacttg gccatggcgggctccagctttctgagccccgaacatcagaaactgcagagaaaggaacct aagaagccatcaggcagactgaagccccgggccctggaaggccagtttgacccggaggtg ggaagtcaggcggaaggtgcagaggacgagctggaaatccggttcaacgccccctttaac gttgggatcaagctatcaggggctcagtccctccagcatggccagacgttggggaagttt cttcaggacatcctttgggaagaagctgaagaaaccctggctgacgagtga

DBGET integrated database retrieval system