KEGG   Bos mutus (wild yak): 102272368
Entry
102272368         CDS       T02919                                 
Symbol
MAPK3
Name
(RefSeq) mitogen-activated protein kinase 3
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
bom  Bos mutus (wild yak)
Pathway
bom01521  EGFR tyrosine kinase inhibitor resistance
bom01522  Endocrine resistance
bom01524  Platinum drug resistance
bom04010  MAPK signaling pathway
bom04012  ErbB signaling pathway
bom04014  Ras signaling pathway
bom04015  Rap1 signaling pathway
bom04022  cGMP-PKG signaling pathway
bom04024  cAMP signaling pathway
bom04062  Chemokine signaling pathway
bom04066  HIF-1 signaling pathway
bom04068  FoxO signaling pathway
bom04071  Sphingolipid signaling pathway
bom04072  Phospholipase D signaling pathway
bom04114  Oocyte meiosis
bom04140  Autophagy - animal
bom04148  Efferocytosis
bom04150  mTOR signaling pathway
bom04151  PI3K-Akt signaling pathway
bom04210  Apoptosis
bom04218  Cellular senescence
bom04261  Adrenergic signaling in cardiomyocytes
bom04270  Vascular smooth muscle contraction
bom04350  TGF-beta signaling pathway
bom04360  Axon guidance
bom04370  VEGF signaling pathway
bom04371  Apelin signaling pathway
bom04380  Osteoclast differentiation
bom04510  Focal adhesion
bom04520  Adherens junction
bom04540  Gap junction
bom04550  Signaling pathways regulating pluripotency of stem cells
bom04611  Platelet activation
bom04613  Neutrophil extracellular trap formation
bom04620  Toll-like receptor signaling pathway
bom04621  NOD-like receptor signaling pathway
bom04625  C-type lectin receptor signaling pathway
bom04650  Natural killer cell mediated cytotoxicity
bom04657  IL-17 signaling pathway
bom04658  Th1 and Th2 cell differentiation
bom04659  Th17 cell differentiation
bom04660  T cell receptor signaling pathway
bom04662  B cell receptor signaling pathway
bom04664  Fc epsilon RI signaling pathway
bom04666  Fc gamma R-mediated phagocytosis
bom04668  TNF signaling pathway
bom04713  Circadian entrainment
bom04720  Long-term potentiation
bom04722  Neurotrophin signaling pathway
bom04723  Retrograde endocannabinoid signaling
bom04724  Glutamatergic synapse
bom04725  Cholinergic synapse
bom04726  Serotonergic synapse
bom04730  Long-term depression
bom04810  Regulation of actin cytoskeleton
bom04910  Insulin signaling pathway
bom04912  GnRH signaling pathway
bom04914  Progesterone-mediated oocyte maturation
bom04915  Estrogen signaling pathway
bom04916  Melanogenesis
bom04917  Prolactin signaling pathway
bom04919  Thyroid hormone signaling pathway
bom04921  Oxytocin signaling pathway
bom04926  Relaxin signaling pathway
bom04928  Parathyroid hormone synthesis, secretion and action
bom04929  GnRH secretion
bom04930  Type II diabetes mellitus
bom04933  AGE-RAGE signaling pathway in diabetic complications
bom04934  Cushing syndrome
bom04935  Growth hormone synthesis, secretion and action
bom04960  Aldosterone-regulated sodium reabsorption
bom05010  Alzheimer disease
bom05020  Prion disease
bom05022  Pathways of neurodegeneration - multiple diseases
bom05034  Alcoholism
bom05132  Salmonella infection
bom05133  Pertussis
bom05135  Yersinia infection
bom05140  Leishmaniasis
bom05142  Chagas disease
bom05145  Toxoplasmosis
bom05152  Tuberculosis
bom05160  Hepatitis C
bom05161  Hepatitis B
bom05163  Human cytomegalovirus infection
bom05164  Influenza A
bom05165  Human papillomavirus infection
bom05166  Human T-cell leukemia virus 1 infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05170  Human immunodeficiency virus 1 infection
bom05171  Coronavirus disease - COVID-19
bom05200  Pathways in cancer
bom05203  Viral carcinogenesis
bom05205  Proteoglycans in cancer
bom05206  MicroRNAs in cancer
bom05207  Chemical carcinogenesis - receptor activation
bom05208  Chemical carcinogenesis - reactive oxygen species
bom05210  Colorectal cancer
bom05211  Renal cell carcinoma
bom05212  Pancreatic cancer
bom05213  Endometrial cancer
bom05214  Glioma
bom05215  Prostate cancer
bom05216  Thyroid cancer
bom05218  Melanoma
bom05219  Bladder cancer
bom05220  Chronic myeloid leukemia
bom05221  Acute myeloid leukemia
bom05223  Non-small cell lung cancer
bom05224  Breast cancer
bom05225  Hepatocellular carcinoma
bom05226  Gastric cancer
bom05230  Central carbon metabolism in cancer
bom05231  Choline metabolism in cancer
bom05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
bom05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102272368 (MAPK3)
   04012 ErbB signaling pathway
    102272368 (MAPK3)
   04014 Ras signaling pathway
    102272368 (MAPK3)
   04015 Rap1 signaling pathway
    102272368 (MAPK3)
   04350 TGF-beta signaling pathway
    102272368 (MAPK3)
   04370 VEGF signaling pathway
    102272368 (MAPK3)
   04371 Apelin signaling pathway
    102272368 (MAPK3)
   04668 TNF signaling pathway
    102272368 (MAPK3)
   04066 HIF-1 signaling pathway
    102272368 (MAPK3)
   04068 FoxO signaling pathway
    102272368 (MAPK3)
   04072 Phospholipase D signaling pathway
    102272368 (MAPK3)
   04071 Sphingolipid signaling pathway
    102272368 (MAPK3)
   04024 cAMP signaling pathway
    102272368 (MAPK3)
   04022 cGMP-PKG signaling pathway
    102272368 (MAPK3)
   04151 PI3K-Akt signaling pathway
    102272368 (MAPK3)
   04150 mTOR signaling pathway
    102272368 (MAPK3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102272368 (MAPK3)
   04148 Efferocytosis
    102272368 (MAPK3)
  09143 Cell growth and death
   04114 Oocyte meiosis
    102272368 (MAPK3)
   04210 Apoptosis
    102272368 (MAPK3)
   04218 Cellular senescence
    102272368 (MAPK3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102272368 (MAPK3)
   04520 Adherens junction
    102272368 (MAPK3)
   04540 Gap junction
    102272368 (MAPK3)
   04550 Signaling pathways regulating pluripotency of stem cells
    102272368 (MAPK3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102272368 (MAPK3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102272368 (MAPK3)
   04613 Neutrophil extracellular trap formation
    102272368 (MAPK3)
   04620 Toll-like receptor signaling pathway
    102272368 (MAPK3)
   04621 NOD-like receptor signaling pathway
    102272368 (MAPK3)
   04625 C-type lectin receptor signaling pathway
    102272368 (MAPK3)
   04650 Natural killer cell mediated cytotoxicity
    102272368 (MAPK3)
   04660 T cell receptor signaling pathway
    102272368 (MAPK3)
   04658 Th1 and Th2 cell differentiation
    102272368 (MAPK3)
   04659 Th17 cell differentiation
    102272368 (MAPK3)
   04657 IL-17 signaling pathway
    102272368 (MAPK3)
   04662 B cell receptor signaling pathway
    102272368 (MAPK3)
   04664 Fc epsilon RI signaling pathway
    102272368 (MAPK3)
   04666 Fc gamma R-mediated phagocytosis
    102272368 (MAPK3)
   04062 Chemokine signaling pathway
    102272368 (MAPK3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102272368 (MAPK3)
   04929 GnRH secretion
    102272368 (MAPK3)
   04912 GnRH signaling pathway
    102272368 (MAPK3)
   04915 Estrogen signaling pathway
    102272368 (MAPK3)
   04914 Progesterone-mediated oocyte maturation
    102272368 (MAPK3)
   04917 Prolactin signaling pathway
    102272368 (MAPK3)
   04921 Oxytocin signaling pathway
    102272368 (MAPK3)
   04926 Relaxin signaling pathway
    102272368 (MAPK3)
   04935 Growth hormone synthesis, secretion and action
    102272368 (MAPK3)
   04919 Thyroid hormone signaling pathway
    102272368 (MAPK3)
   04928 Parathyroid hormone synthesis, secretion and action
    102272368 (MAPK3)
   04916 Melanogenesis
    102272368 (MAPK3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102272368 (MAPK3)
   04270 Vascular smooth muscle contraction
    102272368 (MAPK3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102272368 (MAPK3)
  09156 Nervous system
   04724 Glutamatergic synapse
    102272368 (MAPK3)
   04725 Cholinergic synapse
    102272368 (MAPK3)
   04726 Serotonergic synapse
    102272368 (MAPK3)
   04720 Long-term potentiation
    102272368 (MAPK3)
   04730 Long-term depression
    102272368 (MAPK3)
   04723 Retrograde endocannabinoid signaling
    102272368 (MAPK3)
   04722 Neurotrophin signaling pathway
    102272368 (MAPK3)
  09158 Development and regeneration
   04360 Axon guidance
    102272368 (MAPK3)
   04380 Osteoclast differentiation
    102272368 (MAPK3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102272368 (MAPK3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102272368 (MAPK3)
   05206 MicroRNAs in cancer
    102272368 (MAPK3)
   05205 Proteoglycans in cancer
    102272368 (MAPK3)
   05207 Chemical carcinogenesis - receptor activation
    102272368 (MAPK3)
   05208 Chemical carcinogenesis - reactive oxygen species
    102272368 (MAPK3)
   05203 Viral carcinogenesis
    102272368 (MAPK3)
   05230 Central carbon metabolism in cancer
    102272368 (MAPK3)
   05231 Choline metabolism in cancer
    102272368 (MAPK3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102272368 (MAPK3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102272368 (MAPK3)
   05212 Pancreatic cancer
    102272368 (MAPK3)
   05225 Hepatocellular carcinoma
    102272368 (MAPK3)
   05226 Gastric cancer
    102272368 (MAPK3)
   05214 Glioma
    102272368 (MAPK3)
   05216 Thyroid cancer
    102272368 (MAPK3)
   05221 Acute myeloid leukemia
    102272368 (MAPK3)
   05220 Chronic myeloid leukemia
    102272368 (MAPK3)
   05218 Melanoma
    102272368 (MAPK3)
   05211 Renal cell carcinoma
    102272368 (MAPK3)
   05219 Bladder cancer
    102272368 (MAPK3)
   05215 Prostate cancer
    102272368 (MAPK3)
   05213 Endometrial cancer
    102272368 (MAPK3)
   05224 Breast cancer
    102272368 (MAPK3)
   05223 Non-small cell lung cancer
    102272368 (MAPK3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102272368 (MAPK3)
   05170 Human immunodeficiency virus 1 infection
    102272368 (MAPK3)
   05161 Hepatitis B
    102272368 (MAPK3)
   05160 Hepatitis C
    102272368 (MAPK3)
   05171 Coronavirus disease - COVID-19
    102272368 (MAPK3)
   05164 Influenza A
    102272368 (MAPK3)
   05163 Human cytomegalovirus infection
    102272368 (MAPK3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102272368 (MAPK3)
   05165 Human papillomavirus infection
    102272368 (MAPK3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102272368 (MAPK3)
   05135 Yersinia infection
    102272368 (MAPK3)
   05133 Pertussis
    102272368 (MAPK3)
   05152 Tuberculosis
    102272368 (MAPK3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102272368 (MAPK3)
   05140 Leishmaniasis
    102272368 (MAPK3)
   05142 Chagas disease
    102272368 (MAPK3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102272368 (MAPK3)
   05020 Prion disease
    102272368 (MAPK3)
   05022 Pathways of neurodegeneration - multiple diseases
    102272368 (MAPK3)
  09165 Substance dependence
   05034 Alcoholism
    102272368 (MAPK3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    102272368 (MAPK3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102272368 (MAPK3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102272368 (MAPK3)
   04934 Cushing syndrome
    102272368 (MAPK3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102272368 (MAPK3)
   01524 Platinum drug resistance
    102272368 (MAPK3)
   01522 Endocrine resistance
    102272368 (MAPK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bom01001]
    102272368 (MAPK3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bom03036]
    102272368 (MAPK3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bom04147]
    102272368 (MAPK3)
Enzymes [BR:bom01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     102272368 (MAPK3)
Protein kinases [BR:bom01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   102272368 (MAPK3)
Chromosome and associated proteins [BR:bom03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     102272368 (MAPK3)
Exosome [BR:bom04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102272368 (MAPK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Haspin_kinase FTA2 Kdo
Other DBs
NCBI-GeneID: 102272368
NCBI-ProteinID: XP_005894541
LinkDB
Position
25:complement(15843054..15849830)
AA seq 380 aa
MAAAAAAQGGGGGEPRGTDGVGPGVPGEVEIVKGQPFDVGPRYTQLQYIGEGAYGMVSSA
YDHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRAPTLEAMRDVY
IVQDLMETDLYKLLKSQQLSNDHVCYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCD
LKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEML
SNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKS
DPKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFDMELDDLPKER
LKELIFQETARFQPGVLEAS
NT seq 1143 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggcggctcaggggggcgggggcggggagccccggggaactgatggg
gtcggcccgggggtcccgggggaggtagagatagtaaaggggcagccgttcgacgtgggc
ccgcgctacacgcagctgcagtacatcggcgagggcgcgtacggcatggtcagctcagct
tacgaccacgtgcgcaagactcgagtggccatcaagaaaatcagcccctttgagcatcag
acctactgccagcgcacattgcgagagattcagattctgctgcgcttccgccatgagaac
gtcattggcatccgagacattctgcgggcacccaccctggaagccatgagggatgtctac
atcgtacaggacctgatggagacagacctgtacaaattgctcaaaagccagcagctgagc
aacgaccatgtatgctacttcctgtaccagatcctgcggggcctgaagtatatccactcc
gccaacgtgctccaccgggatttaaagccctccaacctgctcatcaacaccacctgcgac
cttaagatctgtgatttcggtcttgcccggattgctgatcccgagcatgaccacactggc
tttctgacggaatacgtggccacacgctggtaccgggccccagagatcatgcttaactcc
aagggatacaccaagtccatcgacatctggtctgtgggctgcattctggctgagatgctc
tccaaccggcccatcttccccggcaagcactacctggaccagctcaaccacattctgggt
attctgggctccccatcccaggaggacctgaattgtatcatcaacatgaaggcccgaaac
tacctacagtctctgccctccaagaccaaggtggcctgggccaagctttttcctaagtca
gaccccaaagctcttgacctgctggaccggatgttgacctttaaccccaacaaacggatc
acagtggaagaagcgctggctcacccctacctggagcagtactatgacccaacggatgag
ccagtggccgaggaacctttcaccttcgacatggagctggatgatctacccaaggaacga
ctgaaggagctcatcttccaggagacagcccgcttccagcctggggtgctggaagcctcc
taa

DBGET integrated database retrieval system