Bos mutus (wild yak): 102272426 Help Entry 102272426         CDS       T02919                                  Symbol IL2 Name (RefSeq) interleukin-2   KO K05429   interleukin 2 Organism bom  Bos mutus (wild yak) Pathway bom04060   Cytokine-cytokine receptor interaction bom04061   Viral protein interaction with cytokine and cytokine receptor bom04151   PI3K-Akt signaling pathway bom04625   C-type lectin receptor signaling pathway bom04630   JAK-STAT signaling pathway bom04658   Th1 and Th2 cell differentiation bom04659   Th17 cell differentiation bom04660   T cell receptor signaling pathway bom04672   Intestinal immune network for IgA production bom04940   Type I diabetes mellitus bom05135   Yersinia infection bom05142   Chagas disease bom05162   Measles bom05166   Human T-cell leukemia virus 1 infection bom05171   Coronavirus disease bom05200   Pathways in cancer bom05320   Autoimmune thyroid disease bom05321   Inflammatory bowel disease bom05330   Allograft rejection bom05332   Graft-versus-host disease Brite KEGG Orthology (KO) [BR:bom00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     102272426 (IL2)    04151 PI3K-Akt signaling pathway     102272426 (IL2)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102272426 (IL2)    04061 Viral protein interaction with cytokine and cytokine receptor     102272426 (IL2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     102272426 (IL2)    04660 T cell receptor signaling pathway     102272426 (IL2)    04658 Th1 and Th2 cell differentiation     102272426 (IL2)    04659 Th17 cell differentiation     102272426 (IL2)    04672 Intestinal immune network for IgA production     102272426 (IL2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102272426 (IL2)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102272426 (IL2)    05171 Coronavirus disease     102272426 (IL2)    05162 Measles     102272426 (IL2)   09171 Infectious disease: bacterial    05135 Yersinia infection     102272426 (IL2)   09174 Infectious disease: parasitic    05142 Chagas disease     102272426 (IL2)   09163 Immune disease    05320 Autoimmune thyroid disease     102272426 (IL2)    05321 Inflammatory bowel disease     102272426 (IL2)    05330 Allograft rejection     102272426 (IL2)    05332 Graft-versus-host disease     102272426 (IL2)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     102272426 (IL2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bom04052]     102272426 (IL2)    00536 Glycosaminoglycan binding proteins [BR:bom00536]     102272426 (IL2) Cytokines and neuropeptides [BR:bom04052]  Cytokines   Interleukins    102272426 (IL2) Glycosaminoglycan binding proteins [BR:bom00536]  Heparan sulfate / Heparin   Cytokines    102272426 (IL2) SSDB OrthologParalogGFIT Motif Pfam:  IL2 SYN8_N DISC1 Motif Other DBs NCBI-GeneID:  102272426 NCBI-ProteinID:  XP_005908401 UniProt:  L8HS84 LinkDB All DBs Position 17:complement(37351671..37356312) Genome browser AA seq 155 aa AA seqDB search MYKIQLLSCIALTLALVANGAPTSSSTGNTMKEVKSLLLDLQLLLEKVKNPENLKLSRMH TFDFYVPKVNATELKHLKCLLEELKLLEEVLNLAPSKNLNPREIKDSMDNIKRIVLELQG SETRFTCEYDDATVNAVEFLNKWITFCQSIYSTMT NT seq 468 nt NT seq  +upstreamnt  +downstreamnt atgtacaagatacaactcttgtcttgcattgcactaactcttgcactcgttgcaaacggt gcacctacttcaagctctacggggaacacaatgaaagaagtgaagtcattgctgctggat ttacagttgcttttggagaaagttaaaaatcctgagaacctcaagctctccaggatgcat acatttgacttttacgtgcccaaggttaacgctacagaattgaaacatcttaagtgttta ctagaagaactcaaacttctagaggaagtgctaaatttagctccaagcaaaaacctgaac cccagagagatcaaggattcaatggacaatatcaagagaatcgttttggaactacaggga tctgaaacaagattcacatgtgaatatgatgatgcaacagtaaacgctgtagaatttctg aacaaatggattaccttttgtcaaagcatctactcaacaatgacttga

DBGET integrated database retrieval system