Bos mutus (wild yak): 102272429 Help Entry 102272429         CDS       T02919                                  Symbol CLDN7 Name (RefSeq) claudin-7   KO K06087   claudin Organism bom  Bos mutus (wild yak) Pathway bom03272   Virion - Hepatitis viruses bom04382   Cornified envelope formation bom04514   Cell adhesion molecules bom04530   Tight junction bom04670   Leukocyte transendothelial migration bom05160   Hepatitis C Brite KEGG Orthology (KO) [BR:bom00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     102272429 (CLDN7)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     102272429 (CLDN7)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     102272429 (CLDN7)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     102272429 (CLDN7)   09158 Development and regeneration    04382 Cornified envelope formation     102272429 (CLDN7)  09160 Human Diseases   09172 Infectious disease: viral    05160 Hepatitis C     102272429 (CLDN7)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:bom03037]     102272429 (CLDN7)    04147 Exosome [BR:bom04147]     102272429 (CLDN7)    04515 Cell adhesion molecules [BR:bom04515]     102272429 (CLDN7) Cilium and associated proteins [BR:bom03037]  Other cilia and associated proteins   Stereociliary proteins    102272429 (CLDN7) Exosome [BR:bom04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    102272429 (CLDN7)   Exosomal proteins of colorectal cancer cells    102272429 (CLDN7) Cell adhesion molecules [BR:bom04515]  Immunoglobulin superfamily   L1 family    102272429 (CLDN7) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PMP22_Claudin Claudin_2 OppC_N Clc-like Motif Other DBs NCBI-GeneID:  102272429 NCBI-ProteinID:  XP_005890014 UniProt:  L8IVE8 LinkDB All DBs Position 19:complement(13926185..13928442) Genome browser AA seq 211 aa AA seqDB search MANSGLQLLGFSMALLGWVGLVACTAIPQWQMSSYAGDNIITAQAMYKGLWMDCVTQSTG MMSCKMYDSVLSLPAALQATRALMVASLVLGFLATFVATMGMKCTNCGGDDKVKKARIAM TGGIIFILAGLAALIACSWYGHQIVSDFYNPLVPMNVKYEFGPAIFIGWAGSALVLLGGA LLSCSCPGSESKAGYRAPRSYPKPNSAKEYV NT seq 636 nt NT seq  +upstreamnt  +downstreamnt atggccaattcgggcctgcagctgctgggcttttccatggctctgctgggctgggtgggc ctggtggcatgcaccgccatcccgcagtggcagatgagctcgtacgctggcgacaatatc atcaccgcccaggccatgtacaaggggctgtggatggactgcgtcacgcagagcaccggc atgatgagctgcaaaatgtacgactcggtgctctccctgccggcggccttgcaggccact cgagccctaatggtggcctccctggtgctgggcttcctggccacattcgtggccacgatg ggaatgaagtgtacaaactgtggaggagacgacaaagtgaagaaggcccggatagccatg acgggaggcatcattttcatcttggcaggtcttgctgccttgatagcttgctcctggtac ggccatcagattgtctcagatttctataacccattggtccccatgaatgttaagtatgaa tttggtcctgccatcttcattggctgggcagggtctgctctggtcctcctgggaggtgcg ctgctctcttgctcctgtcctgggagtgagagcaaagctggataccgtgcgcctcgctcc taccctaagcccaactctgccaaagagtatgtgtga

DBGET integrated database retrieval system