Bos mutus (wild yak): 102272703 Help Entry 102272703         CDS       T02919                                  Symbol RAB5A Name (RefSeq) ras-related protein Rab-5A   KO K07887   Ras-related protein Rab-5A Organism bom  Bos mutus (wild yak) Pathway bom04014   Ras signaling pathway bom04137   Mitophagy - animal bom04144   Endocytosis bom04145   Phagosome bom04148   Efferocytosis bom04962   Vasopressin-regulated water reabsorption bom05014   Amyotrophic lateral sclerosis bom05022   Pathways of neurodegeneration - multiple diseases bom05132   Salmonella infection bom05146   Amoebiasis bom05152   Tuberculosis Brite KEGG Orthology (KO) [BR:bom00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     102272703 (RAB5A)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     102272703 (RAB5A)    04145 Phagosome     102272703 (RAB5A)    04137 Mitophagy - animal     102272703 (RAB5A)    04148 Efferocytosis     102272703 (RAB5A)  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     102272703 (RAB5A)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102272703 (RAB5A)    05152 Tuberculosis     102272703 (RAB5A)   09174 Infectious disease: parasitic    05146 Amoebiasis     102272703 (RAB5A)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     102272703 (RAB5A)    05022 Pathways of neurodegeneration - multiple diseases     102272703 (RAB5A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bom04131]     102272703 (RAB5A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bom04147]     102272703 (RAB5A)    04031 GTP-binding proteins [BR:bom04031]     102272703 (RAB5A) Membrane trafficking [BR:bom04131]  Endocytosis   Rab GTPases and associated proteins    Rab GTPases     102272703 (RAB5A)  Endosome - Lysosome transport     102272703 (RAB5A) Exosome [BR:bom04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102272703 (RAB5A)   Exosomal proteins of other body fluids (saliva and urine)    102272703 (RAB5A)   Exosomal proteins of colorectal cancer cells    102272703 (RAB5A)   Exosomal proteins of bladder cancer cells    102272703 (RAB5A) GTP-binding proteins [BR:bom04031]  Small (monomeric) G-proteins   Rab Family    Rab5/17/22/31 [OT]     102272703 (RAB5A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA MMR_HSR1 RsgA_GTPase AAA_16 MCR_beta BrnT_toxin Motif Other DBs NCBI-GeneID:  102272703 NCBI-ProteinID:  XP_070233048 LinkDB All DBs Position 1:complement(143452787..143486265) Genome browser AA seq 215 aa AA seqDB search MANRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQ TVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQR QASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKK LPKSEPQNPGAHSTRGRGVDLTEPTQPARGQCCSN NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atggctaatcgaggagcaacaagacccaacgggccaaatactggaaataaaatatgccag ttcaaactagtacttctgggagagtctgctgttggcaaatcaagccttgtgcttcgtttt gtgaagggccagtttcatgaatttcaagagagtaccattggggctgcttttctaactcaa acggtatgtcttgacgacacgacagtaaaatttgaaatatgggatacggctggccaagag cggtaccacagcctggcgcccatgtactacagaggcgcccaggccgccatagtcgtgtac gacatcacgaacgaggagtcctttgccagagccaaaaactgggttaaagagcttcagagg caagccagtcctaacattgtaatagctttatcaggaaacaaggccgatctggcaaataaa agagctgtcgactttcaggaggcacagtcctatgcggatgataacagtttattatttatg gagacatcagctaaaacatcaatgaatgtaaatgaaatattcatggcaatagctaaaaag ttgccaaagagcgaaccacagaatccgggagcacattctaccagaggaagaggagtagac ctcaccgagcccacgcagcccgccaggggtcagtgctgtagtaactag

DBGET integrated database retrieval system