Bos mutus (wild yak): 102272910 Help Entry 102272910         CDS       T02919                                  Symbol IL5 Name (RefSeq) interleukin-5   KO K05428   interleukin 5 Organism bom  Bos mutus (wild yak) Pathway bom04060   Cytokine-cytokine receptor interaction bom04630   JAK-STAT signaling pathway bom04640   Hematopoietic cell lineage bom04657   IL-17 signaling pathway bom04658   Th1 and Th2 cell differentiation bom04660   T cell receptor signaling pathway bom04664   Fc epsilon RI signaling pathway bom04672   Intestinal immune network for IgA production bom05200   Pathways in cancer bom05310   Asthma bom05320   Autoimmune thyroid disease bom05321   Inflammatory bowel disease bom05330   Allograft rejection Brite KEGG Orthology (KO) [BR:bom00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     102272910 (IL5)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102272910 (IL5)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     102272910 (IL5)    04660 T cell receptor signaling pathway     102272910 (IL5)    04658 Th1 and Th2 cell differentiation     102272910 (IL5)    04657 IL-17 signaling pathway     102272910 (IL5)    04664 Fc epsilon RI signaling pathway     102272910 (IL5)    04672 Intestinal immune network for IgA production     102272910 (IL5)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102272910 (IL5)   09163 Immune disease    05310 Asthma     102272910 (IL5)    05320 Autoimmune thyroid disease     102272910 (IL5)    05321 Inflammatory bowel disease     102272910 (IL5)    05330 Allograft rejection     102272910 (IL5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bom04052]     102272910 (IL5)    00536 Glycosaminoglycan binding proteins [BR:bom00536]     102272910 (IL5) Cytokines and neuropeptides [BR:bom04052]  Cytokines   Interleukins    102272910 (IL5) Glycosaminoglycan binding proteins [BR:bom00536]  Heparan sulfate / Heparin   Cytokines    102272910 (IL5) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL5 Motif Other DBs NCBI-GeneID:  102272910 NCBI-ProteinID:  XP_005888427 UniProt:  L8J309 LinkDB All DBs Position 7:61741789..61744520 Genome browser AA seq 134 aa AA seqDB search MRMHLHLTLVALGAAYVCANAVESTMNRLVAETLTLLSSHRILLIGDGNLMIPTPQHTNH QLCIEEVFQGIDTLKNQTAQGDAVKKIFQNLSLIKEYIDLQKRKCGGERWRVKQFLDYLQ VFLGVINTEWTMES NT seq 405 nt NT seq  +upstreamnt  +downstreamnt atgagaatgcatctgcatttgactttagtagctcttggagctgcttatgtttgtgccaat gctgtagaaagtaccatgaatagactggtggcagagaccttgacactgctctcctctcat cgaattctgctgataggtgatgggaacttgatgattcctactcctcagcatacaaatcac caactgtgcattgaagaagtctttcagggaatagacacattgaagaatcaaactgcacaa ggggatgctgtgaaaaaaatattccaaaacttgtctttaataaaagaatacatagacctc caaaaaaggaagtgtggaggagaaagatggagagtgaaacaattcctagactacctgcaa gtttttcttggtgtgattaacacagagtggacaatggaaagttga

DBGET integrated database retrieval system