Bos mutus (wild yak): 102274318 Help Entry 102274318         CDS       T02919                                  Name (RefSeq) histone H3.3A   KO K11253   histone H3 Organism bom  Bos mutus (wild yak) Pathway bom04613   Neutrophil extracellular trap formation bom05034   Alcoholism bom05202   Transcriptional misregulation in cancer bom05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:bom00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     102274318  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     102274318   09163 Immune disease    05322 Systemic lupus erythematosus     102274318   09165 Substance dependence    05034 Alcoholism     102274318  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bom03036]     102274318   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bom04147]     102274318 Chromosome and associated proteins [BR:bom03036]  Eukaryotic type   Nucleosome assembly factors    Histones     102274318 Exosome [BR:bom04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102274318 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF TFIID-31kDa YebU_pre-PUA_dom Motif Other DBs NCBI-GeneID:  102274318 NCBI-ProteinID:  XP_005904534 UniProt:  L8I0H3 LinkDB All DBs Position 6:complement(101866310..101867355) Genome browser AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPKKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE LLIHKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgtacaaagcagactgcccgcaaatcgactggtggtaaagcaccgaagaagcaa ctcgctacaaaagccgctcgcaagagtgcgccctctactggaggggtgaagaaacctcat cgttacaggcctggtactgtggcactccgtgaaattagacgttatcagaagtccactgaa cttctgattcacaaacttcccttccagcgtctggtgcgggaaattgctcaggacttcaaa acagatctgcgcttccagagtgcagctattggtgctttgcaggaggcaagtgaggcctat ctggttggcctttttgaagacaccaacctgtgtgctatccatgccaaacgtgtaacaatt atgccaaaagacatccagctagcacgccgcatacgtggagaacgtgcttaa

DBGET integrated database retrieval system