Bos mutus (wild yak): 102274400 Help Entry 102274400         CDS       T02919                                  Symbol INS Name (RefSeq) insulin   KO K04526   insulin Organism bom  Bos mutus (wild yak) Pathway bom04010   MAPK signaling pathway bom04014   Ras signaling pathway bom04015   Rap1 signaling pathway bom04022   cGMP-PKG signaling pathway bom04066   HIF-1 signaling pathway bom04068   FoxO signaling pathway bom04072   Phospholipase D signaling pathway bom04081   Hormone signaling bom04114   Oocyte meiosis bom04140   Autophagy - animal bom04150   mTOR signaling pathway bom04151   PI3K-Akt signaling pathway bom04152   AMPK signaling pathway bom04211   Longevity regulating pathway bom04213   Longevity regulating pathway - multiple species bom04810   Regulation of actin cytoskeleton bom04910   Insulin signaling pathway bom04911   Insulin secretion bom04913   Ovarian steroidogenesis bom04914   Progesterone-mediated oocyte maturation bom04917   Prolactin signaling pathway bom04923   Regulation of lipolysis in adipocytes bom04930   Type II diabetes mellitus bom04931   Insulin resistance bom04932   Non-alcoholic fatty liver disease bom04940   Type I diabetes mellitus bom04950   Maturity onset diabetes of the young bom04960   Aldosterone-regulated sodium reabsorption bom05010   Alzheimer disease bom05215   Prostate cancer bom05415   Diabetic cardiomyopathy Brite KEGG Orthology (KO) [BR:bom00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102274400 (INS)    04014 Ras signaling pathway     102274400 (INS)    04015 Rap1 signaling pathway     102274400 (INS)    04066 HIF-1 signaling pathway     102274400 (INS)    04068 FoxO signaling pathway     102274400 (INS)    04072 Phospholipase D signaling pathway     102274400 (INS)    04022 cGMP-PKG signaling pathway     102274400 (INS)    04151 PI3K-Akt signaling pathway     102274400 (INS)    04152 AMPK signaling pathway     102274400 (INS)    04150 mTOR signaling pathway     102274400 (INS)   09133 Signaling molecules and interaction    04081 Hormone signaling     102274400 (INS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     102274400 (INS)   09143 Cell growth and death    04114 Oocyte meiosis     102274400 (INS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     102274400 (INS)  09150 Organismal Systems   09152 Endocrine system    04911 Insulin secretion     102274400 (INS)    04910 Insulin signaling pathway     102274400 (INS)    04923 Regulation of lipolysis in adipocytes     102274400 (INS)    04913 Ovarian steroidogenesis     102274400 (INS)    04914 Progesterone-mediated oocyte maturation     102274400 (INS)    04917 Prolactin signaling pathway     102274400 (INS)   09155 Excretory system    04960 Aldosterone-regulated sodium reabsorption     102274400 (INS)   09149 Aging    04211 Longevity regulating pathway     102274400 (INS)    04213 Longevity regulating pathway - multiple species     102274400 (INS)  09160 Human Diseases   09162 Cancer: specific types    05215 Prostate cancer     102274400 (INS)   09164 Neurodegenerative disease    05010 Alzheimer disease     102274400 (INS)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     102274400 (INS)   09167 Endocrine and metabolic disease    04930 Type II diabetes mellitus     102274400 (INS)    04940 Type I diabetes mellitus     102274400 (INS)    04950 Maturity onset diabetes of the young     102274400 (INS)    04932 Non-alcoholic fatty liver disease     102274400 (INS)    04931 Insulin resistance     102274400 (INS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bom04052]     102274400 (INS) Cytokines and neuropeptides [BR:bom04052]  Neuropeptides   Unclassified    102274400 (INS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Ins_beta Motif Other DBs NCBI-GeneID:  102274400 NCBI-ProteinID:  XP_070216572 LinkDB All DBs Position 22:complement(62402916..62403710) Genome browser AA seq 105 aa AA seqDB search MALWTRLAPLLALLALWAPAPARAFVNQHLCGSHLVEALYLVCGERGFFYTPKARREVEG PQVGALELAGGPGAGGLEGPPQKRGIVEQCCASVCSLYQLENYCN NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggccctgtggacacgcctggcgcccctgctggccctgctggcgctctgggcccccgcc ccggcccgcgccttcgtcaaccagcatctgtgtggctcccacctggtggaggcgctgtac ctggtgtgcggagagcgcggcttcttctacacgcccaaggcccgccgggaggtggagggc ccccaggtgggggcgctggagctggccggaggcccgggcgcgggcggcctggaggggccc ccgcagaagcgcggcatcgtggagcagtgctgtgccagcgtctgctcactctaccagctg gagaactactgtaactag

DBGET integrated database retrieval system