Bos mutus (wild yak): 102275363 Help Entry 102275363         CDS       T02919                                  Name (RefSeq) histone H4   KO K11254   histone H4 Organism bom  Bos mutus (wild yak) Pathway bom04613   Neutrophil extracellular trap formation bom05034   Alcoholism bom05203   Viral carcinogenesis bom05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:bom00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     102275363  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     102275363   09163 Immune disease    05322 Systemic lupus erythematosus     102275363   09165 Substance dependence    05034 Alcoholism     102275363  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bom03036]     102275363 Chromosome and associated proteins [BR:bom03036]  Eukaryotic type   Nucleosome assembly factors    Histones     102275363 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137 Motif Other DBs NCBI-GeneID:  102275363 NCBI-ProteinID:  XP_005905833 UniProt:  L8HXR5 LinkDB All DBs Position Un AA seq 103 aa AA seqDB search MSGRGKGGKDLGKGGAKRHCKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtctggacgcggcaaaggcggcaaagatctggggaaaggcggcgctaagcgccactgt aaggttctacgcgacaacatccagggcatcactaaacctgctatccgccgcctggctcgt cgtggtggtgtgaagcgcatctctgggctcatctacgaagagacccgcggggtcctgaaa gtgtttctggagaacgtgatccgggacgcggtcacctacaccgagcatgccaagcggaag acagtcaccgctatggacgtggtctacgctctcaagcgccagggccgtactctctacggc tttggcggttaa

DBGET integrated database retrieval system