Bos mutus (wild yak): 102275402 Help Entry 102275402         CDS       T02919                                  Symbol NFKBIA Name (RefSeq) NF-kappa-B inhibitor alpha   KO K04734   NF-kappa-B inhibitor alpha Organism bom  Bos mutus (wild yak) Pathway bom04024   cAMP signaling pathway bom04062   Chemokine signaling pathway bom04064   NF-kappa B signaling pathway bom04210   Apoptosis bom04380   Osteoclast differentiation bom04620   Toll-like receptor signaling pathway bom04621   NOD-like receptor signaling pathway bom04622   RIG-I-like receptor signaling pathway bom04623   Cytosolic DNA-sensing pathway bom04625   C-type lectin receptor signaling pathway bom04657   IL-17 signaling pathway bom04658   Th1 and Th2 cell differentiation bom04659   Th17 cell differentiation bom04660   T cell receptor signaling pathway bom04662   B cell receptor signaling pathway bom04668   TNF signaling pathway bom04722   Neurotrophin signaling pathway bom04920   Adipocytokine signaling pathway bom04926   Relaxin signaling pathway bom04931   Insulin resistance bom04936   Alcoholic liver disease bom05132   Salmonella infection bom05134   Legionellosis bom05135   Yersinia infection bom05140   Leishmaniasis bom05142   Chagas disease bom05145   Toxoplasmosis bom05160   Hepatitis C bom05161   Hepatitis B bom05162   Measles bom05163   Human cytomegalovirus infection bom05164   Influenza A bom05166   Human T-cell leukemia virus 1 infection bom05167   Kaposi sarcoma-associated herpesvirus infection bom05168   Herpes simplex virus 1 infection bom05169   Epstein-Barr virus infection bom05170   Human immunodeficiency virus 1 infection bom05171   Coronavirus disease - COVID-19 bom05200   Pathways in cancer bom05203   Viral carcinogenesis bom05208   Chemical carcinogenesis - reactive oxygen species bom05215   Prostate cancer bom05220   Chronic myeloid leukemia bom05222   Small cell lung cancer bom05235   PD-L1 expression and PD-1 checkpoint pathway in cancer bom05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:bom00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     102275402 (NFKBIA)    04668 TNF signaling pathway     102275402 (NFKBIA)    04024 cAMP signaling pathway     102275402 (NFKBIA)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     102275402 (NFKBIA)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     102275402 (NFKBIA)    04621 NOD-like receptor signaling pathway     102275402 (NFKBIA)    04622 RIG-I-like receptor signaling pathway     102275402 (NFKBIA)    04623 Cytosolic DNA-sensing pathway     102275402 (NFKBIA)    04625 C-type lectin receptor signaling pathway     102275402 (NFKBIA)    04660 T cell receptor signaling pathway     102275402 (NFKBIA)    04658 Th1 and Th2 cell differentiation     102275402 (NFKBIA)    04659 Th17 cell differentiation     102275402 (NFKBIA)    04657 IL-17 signaling pathway     102275402 (NFKBIA)    04662 B cell receptor signaling pathway     102275402 (NFKBIA)    04062 Chemokine signaling pathway     102275402 (NFKBIA)   09152 Endocrine system    04920 Adipocytokine signaling pathway     102275402 (NFKBIA)    04926 Relaxin signaling pathway     102275402 (NFKBIA)   09156 Nervous system    04722 Neurotrophin signaling pathway     102275402 (NFKBIA)   09158 Development and regeneration    04380 Osteoclast differentiation     102275402 (NFKBIA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102275402 (NFKBIA)    05208 Chemical carcinogenesis - reactive oxygen species     102275402 (NFKBIA)    05203 Viral carcinogenesis     102275402 (NFKBIA)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     102275402 (NFKBIA)   09162 Cancer: specific types    05220 Chronic myeloid leukemia     102275402 (NFKBIA)    05215 Prostate cancer     102275402 (NFKBIA)    05222 Small cell lung cancer     102275402 (NFKBIA)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102275402 (NFKBIA)    05170 Human immunodeficiency virus 1 infection     102275402 (NFKBIA)    05161 Hepatitis B     102275402 (NFKBIA)    05160 Hepatitis C     102275402 (NFKBIA)    05171 Coronavirus disease - COVID-19     102275402 (NFKBIA)    05164 Influenza A     102275402 (NFKBIA)    05162 Measles     102275402 (NFKBIA)    05168 Herpes simplex virus 1 infection     102275402 (NFKBIA)    05163 Human cytomegalovirus infection     102275402 (NFKBIA)    05167 Kaposi sarcoma-associated herpesvirus infection     102275402 (NFKBIA)    05169 Epstein-Barr virus infection     102275402 (NFKBIA)   09171 Infectious disease: bacterial    05132 Salmonella infection     102275402 (NFKBIA)    05135 Yersinia infection     102275402 (NFKBIA)    05134 Legionellosis     102275402 (NFKBIA)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     102275402 (NFKBIA)    05140 Leishmaniasis     102275402 (NFKBIA)    05142 Chagas disease     102275402 (NFKBIA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102275402 (NFKBIA)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     102275402 (NFKBIA)    04931 Insulin resistance     102275402 (NFKBIA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:bom03000]     102275402 (NFKBIA)    04131 Membrane trafficking [BR:bom04131]     102275402 (NFKBIA) Transcription factors [BR:bom03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Ankyrin only     102275402 (NFKBIA) Membrane trafficking [BR:bom04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     102275402 (NFKBIA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ank_2 Ank Ank_3 Ank_5 Ank_4 ANK_LRRK2 Motif Other DBs NCBI-GeneID:  102275402 NCBI-ProteinID:  XP_070214833 LinkDB All DBs Position 21:complement(44751607..44755036) Genome browser AA seq 314 aa AA seqDB search MFQPAEPGQDWAMEGPRDALKKERLLDDRHDSGLDSMKDEEYEQMVKELREIRLEPQEAP RGAEPWKQQLTEDGDSFLHLAIIHEEKALTMEVVRQVKGDLAFLNFQNNLQQTPLHLAVI TNQPEIAEALLEAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQPRGTQHLHSILQATN YNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCG ADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQTLPESEDEESYDTESEFTEDEL PYDDCVLGGQRLTL NT seq 945 nt NT seq  +upstreamnt  +downstreamnt atgttccagcctgccgagcccggccaagattgggccatggagggcccccgggacgcgctc aagaaggagcggctgctggacgaccgccacgacagcggcctggactccatgaaggacgag gagtatgagcagatggtgaaggagctgcgagagatccgcctcgagccgcaggaggcgccg cgcggcgccgagccctggaaacagcagctcaccgaggacggagactcgttcctgcactta gccatcatccatgaagagaaggcgctgaccatggaagtggtccgccaagtgaagggagac ctggccttcctcaacttccagaacaacctgcagcagacgccactccacttggctgtgatc actaaccagccagaaatcgctgaggcacttctggaagctggctgtgatcctgagctgcga gactttcgaggaaatacccccctacaccttgcctgtgagcagggctgcctggccagtgtg ggagtcctgactcagccccgggggacccagcacctccactccatcctgcaggccaccaac tacaatggccacacgtgtctgcacttggcctctattcatggctacctgggcatcgtggag ctgttggtgtccttgggcgctgatgtcaacgctcaggagccctgcaatggccgaactgcc ctccatctggcagtggacctgcagaatcccgacctggtgtcactcctattgaagtgtggg gctgatgtcaacagagtcacctaccagggctactccccgtaccagctcacgtggggccgc cccagcacccggatacagcagcagctgggccagctgaccctagagaaccttcagacactg ccggagagcgaggatgaggagagctatgacaccgaatcagagttcacagaggacgagctt ccctacgatgactgtgtgcttggaggccagcgtctgacgttatga

DBGET integrated database retrieval system