Bos mutus (wild yak): 102275654 Help Entry 102275654         CDS       T02919                                  Symbol PFN1 Name (RefSeq) profilin-1   KO K05759   profilin Organism bom  Bos mutus (wild yak) Pathway bom04015   Rap1 signaling pathway bom04810   Regulation of actin cytoskeleton bom05014   Amyotrophic lateral sclerosis bom05132   Salmonella infection Brite KEGG Orthology (KO) [BR:bom00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     102275654 (PFN1)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     102275654 (PFN1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102275654 (PFN1)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     102275654 (PFN1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bom04131]     102275654 (PFN1)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:bom04812]     102275654 (PFN1)    04147 Exosome [BR:bom04147]     102275654 (PFN1) Membrane trafficking [BR:bom04131]  Others   Actin-binding proteins    Others     102275654 (PFN1) Cytoskeleton proteins [BR:bom04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      102275654 (PFN1) Exosome [BR:bom04147]  Exosomal proteins   Proteins found in most exosomes    102275654 (PFN1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  102275654 NCBI-ProteinID:  XP_070245417 LinkDB All DBs Position 19:13405365..13408044 Genome browser AA seq 140 aa AA seqDB search MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGILVGKDRSSFF VNGLTLGGQKCSVIRDSLLQDGEFTMDLRTKSTGGAPTFNITVTMTAKTLVLLMGKEGVH GGMINKKCYEMASHLRRSQY NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccgggtggaacgcctacatcgacaacctcatggcggacgggacctgtcaggacgca gccatcgtgggctataaggactcgccctccgtctgggccgccgtccccggcaagaccttc gtcaacatcacgcctgctgaggtcggtatcctggttggcaaagaccggtcaagttttttc gtgaacgggctaacacttgggggccagaaatgttctgtgatccgggactcactgctgcag gatggagaatttaccatggatcttcgtaccaagagcaccggtggagccccaaccttcaat atcacggtcaccatgactgccaagacgctagtcctgctgatgggcaaagaaggtgtccac ggcggtatgatcaacaagaaatgttatgaaatggcttctcacctgcggcgttcccagtac tga

DBGET integrated database retrieval system