Bos mutus (wild yak): 102276664 Help Entry 102276664         CDS       T02919                                  Name (RefSeq) histone H4-like   KO K11254   histone H4 Organism bom  Bos mutus (wild yak) Pathway bom04613   Neutrophil extracellular trap formation bom05034   Alcoholism bom05203   Viral carcinogenesis bom05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:bom00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     102276664  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     102276664   09163 Immune disease    05322 Systemic lupus erythematosus     102276664   09165 Substance dependence    05034 Alcoholism     102276664  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bom03036]     102276664 Chromosome and associated proteins [BR:bom03036]  Eukaryotic type   Nucleosome assembly factors    Histones     102276664 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP Motif Other DBs NCBI-GeneID:  102276664 NCBI-ProteinID:  XP_014335706 LinkDB All DBs Position Un AA seq 103 aa AA seqDB search MSGCGKGGKGLGKGGAKRHRKVLRDNIHGITKPAIRRLARRGGVKRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtctggatgcggcaaaggcggcaaaggtctggggaaaggcggcgctaagcgccaccgt aaggttctgcgcgacaacatccacggcatcactaaacctgctatccgccgcctggctcgg cgtgggggtgtgaagcgcatctctgggctcatctacgaagagacccgcggggtcctgaaa gtgtttctggagaacgtgatccgggacgcggtcacctacaccgagcatgccaagcggaag acggtcaccgctatggacgtggtctacgctctcaagcgccagggccgtactctctacggc tttggcggttaa

DBGET integrated database retrieval system