Bos mutus (wild yak): 102276866 Help Entry 102276866         CDS       T02919                                  Name (RefSeq) cytochrome c   KO K08738   cytochrome c Organism bom  Bos mutus (wild yak) Pathway bom00190   Oxidative phosphorylation bom01100   Metabolic pathways bom01524   Platinum drug resistance bom04115   p53 signaling pathway bom04210   Apoptosis bom04215   Apoptosis - multiple species bom04932   Non-alcoholic fatty liver disease bom05010   Alzheimer disease bom05012   Parkinson disease bom05014   Amyotrophic lateral sclerosis bom05016   Huntington disease bom05017   Spinocerebellar ataxia bom05020   Prion disease bom05022   Pathways of neurodegeneration - multiple diseases bom05132   Salmonella infection bom05134   Legionellosis bom05145   Toxoplasmosis bom05152   Tuberculosis bom05160   Hepatitis C bom05161   Hepatitis B bom05162   Measles bom05163   Human cytomegalovirus infection bom05164   Influenza A bom05167   Kaposi sarcoma-associated herpesvirus infection bom05168   Herpes simplex virus 1 infection bom05169   Epstein-Barr virus infection bom05170   Human immunodeficiency virus 1 infection bom05200   Pathways in cancer bom05210   Colorectal cancer bom05222   Small cell lung cancer bom05416   Viral myocarditis bom05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:bom00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     102276866  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     102276866    04215 Apoptosis - multiple species     102276866    04115 p53 signaling pathway     102276866  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102276866   09162 Cancer: specific types    05210 Colorectal cancer     102276866    05222 Small cell lung cancer     102276866   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102276866    05161 Hepatitis B     102276866    05160 Hepatitis C     102276866    05164 Influenza A     102276866    05162 Measles     102276866    05168 Herpes simplex virus 1 infection     102276866    05163 Human cytomegalovirus infection     102276866    05167 Kaposi sarcoma-associated herpesvirus infection     102276866    05169 Epstein-Barr virus infection     102276866   09171 Infectious disease: bacterial    05132 Salmonella infection     102276866    05134 Legionellosis     102276866    05152 Tuberculosis     102276866   09174 Infectious disease: parasitic    05145 Toxoplasmosis     102276866   09164 Neurodegenerative disease    05010 Alzheimer disease     102276866    05012 Parkinson disease     102276866    05014 Amyotrophic lateral sclerosis     102276866    05016 Huntington disease     102276866    05017 Spinocerebellar ataxia     102276866    05020 Prion disease     102276866    05022 Pathways of neurodegeneration - multiple diseases     102276866   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102276866    05416 Viral myocarditis     102276866   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     102276866   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     102276866 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cytochrom_C Cytochrome_CBB3 Motif Other DBs NCBI-GeneID:  102276866 NCBI-ProteinID:  XP_005886722 UniProt:  L8J2S8 LinkDB All DBs Position 1:complement(106595177..106595491) Genome browser AA seq 104 aa AA seqDB search MDNVEKDKIFIQKCVQCHTMDKGGRHKIEPNLHGLFGQKTGQAPGFSYTDSNRNKGISWG EETLMGYMENPKKYIRGTKMIFTGIKKMAERADLIVYPPKATNE NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atggataatgttgaaaaggacaagatttttattcagaagtgtgtccagtgccataccatg gataagggaggcaggcacaagattgagccaaatctccatggtctttttgggcaaaagaca ggtcaggcccctggattttcttacacagattccaacagaaacaaaggcatctcttgggga gaggagacactgatggggtatatggagaatcccaagaagtacattcgtggaacaaaaatg atcttcacgggcattaaaaagatggcagaaagggcagacttaatagtttatcccccaaaa gctactaatgagtaa

DBGET integrated database retrieval system