Bos mutus (wild yak): 102276911 Help Entry 102276911         CDS       T02919                                  Symbol H2AC21 Name (RefSeq) histone H2A type 2-B   KO K11251   histone H2A Organism bom  Bos mutus (wild yak) Pathway bom03082   ATP-dependent chromatin remodeling bom04217   Necroptosis bom04613   Neutrophil extracellular trap formation bom05034   Alcoholism bom05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:bom00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     102276911 (H2AC21)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     102276911 (H2AC21)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     102276911 (H2AC21)  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     102276911 (H2AC21)   09165 Substance dependence    05034 Alcoholism     102276911 (H2AC21)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bom03036]     102276911 (H2AC21)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bom04147]     102276911 (H2AC21) Chromosome and associated proteins [BR:bom03036]  Eukaryotic type   Nucleosome assembly factors    Histones     102276911 (H2AC21) Exosome [BR:bom04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102276911 (H2AC21) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  102276911 NCBI-ProteinID:  XP_005894933 UniProt:  L8IKS0 LinkDB All DBs Position 3:17783320..17783786 Genome browser AA seq 130 aa AA seqDB search MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK TESHKPGKNK NT seq 393 nt NT seq  +upstreamnt  +downstreamnt atgtcaggccgcggaaagcagggaggcaaagctcgggccaaggccaagtcgcgctcatcc cgcgctggccttcagttccccgtagggcgagtgcaccgcctgctgcgcaaagggaactac gccgaaagggtgggggccggcgcaccggtgtacttggcggcagtgctggagtacctgacc gcggaaatcctggagctggcgggcaacgccgcccgagacaacaagaagacgcgcatcatc cctcgccatttgcaactggccgtgagaaatgatgaagagctcaacaagttactcgggggt gtcactattgcccagggcggtgtcttacccaatatccaggcagtcttattgcctaaaaaa acggagagtcacaagcctggcaagaataagtaa

DBGET integrated database retrieval system