KEGG   Bos mutus (wild yak): 102277011
Entry
102277011         CDS       T02919                                 
Symbol
HRAS
Name
(RefSeq) HRas proto-oncogene, GTPase
  KO
K02833  GTPase HRas
Organism
bom  Bos mutus (wild yak)
Pathway
bom01521  EGFR tyrosine kinase inhibitor resistance
bom01522  Endocrine resistance
bom04010  MAPK signaling pathway
bom04012  ErbB signaling pathway
bom04014  Ras signaling pathway
bom04015  Rap1 signaling pathway
bom04062  Chemokine signaling pathway
bom04068  FoxO signaling pathway
bom04071  Sphingolipid signaling pathway
bom04072  Phospholipase D signaling pathway
bom04137  Mitophagy - animal
bom04140  Autophagy - animal
bom04144  Endocytosis
bom04150  mTOR signaling pathway
bom04151  PI3K-Akt signaling pathway
bom04210  Apoptosis
bom04211  Longevity regulating pathway
bom04213  Longevity regulating pathway - multiple species
bom04218  Cellular senescence
bom04360  Axon guidance
bom04370  VEGF signaling pathway
bom04371  Apelin signaling pathway
bom04510  Focal adhesion
bom04540  Gap junction
bom04550  Signaling pathways regulating pluripotency of stem cells
bom04625  C-type lectin receptor signaling pathway
bom04630  JAK-STAT signaling pathway
bom04650  Natural killer cell mediated cytotoxicity
bom04660  T cell receptor signaling pathway
bom04662  B cell receptor signaling pathway
bom04664  Fc epsilon RI signaling pathway
bom04714  Thermogenesis
bom04720  Long-term potentiation
bom04722  Neurotrophin signaling pathway
bom04725  Cholinergic synapse
bom04726  Serotonergic synapse
bom04730  Long-term depression
bom04810  Regulation of actin cytoskeleton
bom04910  Insulin signaling pathway
bom04912  GnRH signaling pathway
bom04915  Estrogen signaling pathway
bom04916  Melanogenesis
bom04917  Prolactin signaling pathway
bom04919  Thyroid hormone signaling pathway
bom04921  Oxytocin signaling pathway
bom04926  Relaxin signaling pathway
bom04929  GnRH secretion
bom04933  AGE-RAGE signaling pathway in diabetic complications
bom04935  Growth hormone synthesis, secretion and action
bom05010  Alzheimer disease
bom05022  Pathways of neurodegeneration - multiple diseases
bom05034  Alcoholism
bom05132  Salmonella infection
bom05160  Hepatitis C
bom05161  Hepatitis B
bom05163  Human cytomegalovirus infection
bom05165  Human papillomavirus infection
bom05166  Human T-cell leukemia virus 1 infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05170  Human immunodeficiency virus 1 infection
bom05200  Pathways in cancer
bom05203  Viral carcinogenesis
bom05205  Proteoglycans in cancer
bom05206  MicroRNAs in cancer
bom05207  Chemical carcinogenesis - receptor activation
bom05208  Chemical carcinogenesis - reactive oxygen species
bom05210  Colorectal cancer
bom05211  Renal cell carcinoma
bom05213  Endometrial cancer
bom05214  Glioma
bom05215  Prostate cancer
bom05216  Thyroid cancer
bom05218  Melanoma
bom05219  Bladder cancer
bom05220  Chronic myeloid leukemia
bom05221  Acute myeloid leukemia
bom05223  Non-small cell lung cancer
bom05224  Breast cancer
bom05225  Hepatocellular carcinoma
bom05226  Gastric cancer
bom05230  Central carbon metabolism in cancer
bom05231  Choline metabolism in cancer
bom05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
bom05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102277011 (HRAS)
   04012 ErbB signaling pathway
    102277011 (HRAS)
   04014 Ras signaling pathway
    102277011 (HRAS)
   04015 Rap1 signaling pathway
    102277011 (HRAS)
   04370 VEGF signaling pathway
    102277011 (HRAS)
   04371 Apelin signaling pathway
    102277011 (HRAS)
   04630 JAK-STAT signaling pathway
    102277011 (HRAS)
   04068 FoxO signaling pathway
    102277011 (HRAS)
   04072 Phospholipase D signaling pathway
    102277011 (HRAS)
   04071 Sphingolipid signaling pathway
    102277011 (HRAS)
   04151 PI3K-Akt signaling pathway
    102277011 (HRAS)
   04150 mTOR signaling pathway
    102277011 (HRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102277011 (HRAS)
   04140 Autophagy - animal
    102277011 (HRAS)
   04137 Mitophagy - animal
    102277011 (HRAS)
  09143 Cell growth and death
   04210 Apoptosis
    102277011 (HRAS)
   04218 Cellular senescence
    102277011 (HRAS)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102277011 (HRAS)
   04540 Gap junction
    102277011 (HRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    102277011 (HRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102277011 (HRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102277011 (HRAS)
   04650 Natural killer cell mediated cytotoxicity
    102277011 (HRAS)
   04660 T cell receptor signaling pathway
    102277011 (HRAS)
   04662 B cell receptor signaling pathway
    102277011 (HRAS)
   04664 Fc epsilon RI signaling pathway
    102277011 (HRAS)
   04062 Chemokine signaling pathway
    102277011 (HRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102277011 (HRAS)
   04929 GnRH secretion
    102277011 (HRAS)
   04912 GnRH signaling pathway
    102277011 (HRAS)
   04915 Estrogen signaling pathway
    102277011 (HRAS)
   04917 Prolactin signaling pathway
    102277011 (HRAS)
   04921 Oxytocin signaling pathway
    102277011 (HRAS)
   04926 Relaxin signaling pathway
    102277011 (HRAS)
   04935 Growth hormone synthesis, secretion and action
    102277011 (HRAS)
   04919 Thyroid hormone signaling pathway
    102277011 (HRAS)
   04916 Melanogenesis
    102277011 (HRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    102277011 (HRAS)
   04726 Serotonergic synapse
    102277011 (HRAS)
   04720 Long-term potentiation
    102277011 (HRAS)
   04730 Long-term depression
    102277011 (HRAS)
   04722 Neurotrophin signaling pathway
    102277011 (HRAS)
  09158 Development and regeneration
   04360 Axon guidance
    102277011 (HRAS)
  09149 Aging
   04211 Longevity regulating pathway
    102277011 (HRAS)
   04213 Longevity regulating pathway - multiple species
    102277011 (HRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    102277011 (HRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102277011 (HRAS)
   05206 MicroRNAs in cancer
    102277011 (HRAS)
   05205 Proteoglycans in cancer
    102277011 (HRAS)
   05207 Chemical carcinogenesis - receptor activation
    102277011 (HRAS)
   05208 Chemical carcinogenesis - reactive oxygen species
    102277011 (HRAS)
   05203 Viral carcinogenesis
    102277011 (HRAS)
   05230 Central carbon metabolism in cancer
    102277011 (HRAS)
   05231 Choline metabolism in cancer
    102277011 (HRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102277011 (HRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102277011 (HRAS)
   05225 Hepatocellular carcinoma
    102277011 (HRAS)
   05226 Gastric cancer
    102277011 (HRAS)
   05214 Glioma
    102277011 (HRAS)
   05216 Thyroid cancer
    102277011 (HRAS)
   05221 Acute myeloid leukemia
    102277011 (HRAS)
   05220 Chronic myeloid leukemia
    102277011 (HRAS)
   05218 Melanoma
    102277011 (HRAS)
   05211 Renal cell carcinoma
    102277011 (HRAS)
   05219 Bladder cancer
    102277011 (HRAS)
   05215 Prostate cancer
    102277011 (HRAS)
   05213 Endometrial cancer
    102277011 (HRAS)
   05224 Breast cancer
    102277011 (HRAS)
   05223 Non-small cell lung cancer
    102277011 (HRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102277011 (HRAS)
   05170 Human immunodeficiency virus 1 infection
    102277011 (HRAS)
   05161 Hepatitis B
    102277011 (HRAS)
   05160 Hepatitis C
    102277011 (HRAS)
   05163 Human cytomegalovirus infection
    102277011 (HRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102277011 (HRAS)
   05165 Human papillomavirus infection
    102277011 (HRAS)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102277011 (HRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102277011 (HRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    102277011 (HRAS)
  09165 Substance dependence
   05034 Alcoholism
    102277011 (HRAS)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    102277011 (HRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102277011 (HRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102277011 (HRAS)
   01522 Endocrine resistance
    102277011 (HRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bom04131]
    102277011 (HRAS)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bom04147]
    102277011 (HRAS)
   04031 GTP-binding proteins [BR:bom04031]
    102277011 (HRAS)
Membrane trafficking [BR:bom04131]
 Exocytosis
  Small GTPases and associated proteins
   Other small GTPases and associated proteins
    102277011 (HRAS)
 Endocytosis
  Macropinocytosis
   Ras GTPases
    102277011 (HRAS)
Exosome [BR:bom04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102277011 (HRAS)
  Exosomal proteins of colorectal cancer cells
   102277011 (HRAS)
GTP-binding proteins [BR:bom04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    102277011 (HRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N G-alpha ATP_bind_1 Septin Ldh_1_N CdhD AAA_14
Other DBs
NCBI-GeneID: 102277011
NCBI-ProteinID: XP_005895180
LinkDB
Position
Un
AA seq 170 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINHVKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL
AARTVESRQAQDLARSYGIPYIETSAKTRQGSRSGSGSSSGTLWDPPGPP
NT seq 513 nt   +upstreamnt  +downstreamnt
atgacggagtataagctcgtggtggtgggcgccggtggcgtggggaagagcgccctgact
atccagctcattcagaatcacttcgtggacgagtacgaccccaccatcgaggactcctac
cggaagcaagtggtcatcgatggggagacgtgcctgctggacatcctggacacagcgggc
caggaggagtacagcgccatgcgagaccagtacatgcgcaccggggagggctttctctgc
gtgtttgctatcaaccacgtcaagtccttcgaggacatccaccagtaccgggagcagatc
aagcgggtgaaggactcggatgacgtgcccatggtgttggttgggaacaagtgcgacctg
gctgcgcgcaccgtggagtctcggcaggcccaggacctcgcccgcagctacggcatcccg
tacatcgagacctccgccaagacccgccagggcagccgctctggctctggctccagctcc
gggaccctctgggaccctccgggacccccgtga

DBGET integrated database retrieval system