Bos mutus (wild yak): 102277395 Help Entry 102277395         CDS       T02919                                  Symbol CFL1, Cofilin-1 Name (RefSeq) cofilin 1   KO K05765   cofilin Organism bom  Bos mutus (wild yak) Pathway bom04360   Axon guidance bom04666   Fc gamma R-mediated phagocytosis bom04810   Regulation of actin cytoskeleton bom05133   Pertussis bom05170   Human immunodeficiency virus 1 infection Brite KEGG Orthology (KO) [BR:bom00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     102277395 (CFL1)  09150 Organismal Systems   09151 Immune system    04666 Fc gamma R-mediated phagocytosis     102277395 (CFL1)   09158 Development and regeneration    04360 Axon guidance     102277395 (CFL1)  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102277395 (CFL1)   09171 Infectious disease: bacterial    05133 Pertussis     102277395 (CFL1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bom04131]     102277395 (CFL1)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:bom04812]     102277395 (CFL1)    04147 Exosome [BR:bom04147]     102277395 (CFL1) Membrane trafficking [BR:bom04131]  Others   Actin-binding proteins    Others     102277395 (CFL1) Cytoskeleton proteins [BR:bom04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     ADF / Cofilin      102277395 (CFL1) Exosome [BR:bom04147]  Exosomal proteins   Proteins found in most exosomes    102277395 (CFL1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cofilin_ADF Motif Other DBs NCBI-GeneID:  102277395 NCBI-ProteinID:  XP_005894099 LinkDB All DBs Position Un AA seq 166 aa AA seqDB search MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDV GQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPECAPLKSKMIYASS KDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL NT seq 501 nt NT seq  +upstreamnt  +downstreamnt atggcctccggtgtggctgtctctgatggggtcatcaaagtgttcaacgacatgaaagtg cgtaagtcgtcgacaccagaggaagtgaagaagcgcaagaaggcggtgctcttctgcctg agtgaggacaagaagaacatcatcctggaggagggcaaggagatcctggtgggtgacgtg ggccagacggtagacgacccctatgccacctttgtcaagatgctgccagacaaggactgc cgctacgccctctacgatgcaacctacgagaccaaggagagcaagaaggaggacctggtg ttcatcttctgggcccctgagtgtgcaccccttaagagcaaaatgatctatgccagctcc aaggatgccatcaagaagaaactgacggggatcaagcatgaattacaagcaaactgctac gaggaggtcaaggaccgctgcacccttgcagagaagctggggggcagcgctgtcatctcc ctggagggcaagcctttgtga

DBGET integrated database retrieval system