Bos mutus (wild yak): 102277538 Help Entry 102277538         CDS       T02919                                  Name (RefSeq) histone H4-like   KO K11254   histone H4 Organism bom  Bos mutus (wild yak) Pathway bom04613   Neutrophil extracellular trap formation bom05034   Alcoholism bom05203   Viral carcinogenesis bom05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:bom00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     102277538  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     102277538   09163 Immune disease    05322 Systemic lupus erythematosus     102277538   09165 Substance dependence    05034 Alcoholism     102277538  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bom03036]     102277538 Chromosome and associated proteins [BR:bom03036]  Eukaryotic type   Nucleosome assembly factors    Histones     102277538 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CENP-T_C TAF Histone CBFD_NFYB_HMF CENP-S HIGH_NTase1_ass Motif Other DBs NCBI-GeneID:  102277538 NCBI-ProteinID:  XP_014337585 UniProt:  L8HV69 LinkDB All DBs Position Un AA seq 88 aa AA seqDB search MSGRGKGGKGRGKGGAKRHRKVLCNNIQGITKPAIRCLARRGDVKRISGLICKETRRVLK VFLENVIRDAVTYTKHAKRKTVTAIDVV NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgtccggacgcggcaaaggcggcaaaggccgggggaaaggcggcgctaagcgccaccgc aaggttctgtgcaacaacatccagggcatcactaagcctgctatccgctgcctggctcgt cgtggtgatgtgaagcgcatctctgggctcatttgcaaggagacccgtagggtcctaaaa gtatttctggagaacgtgatccgggacgcggtcacctacaccaagcacgccaagcggaag actgtcaccgccatagatgtggtctag

DBGET integrated database retrieval system