Bos mutus (wild yak): 102278637 Help Entry 102278637         CDS       T02919                                  Name (RefSeq) uncharacterized protein   KO K16598   C-C motif chemokine 27 Organism bom  Bos mutus (wild yak) Pathway bom04060   Cytokine-cytokine receptor interaction bom04061   Viral protein interaction with cytokine and cytokine receptor bom04062   Chemokine signaling pathway Brite KEGG Orthology (KO) [BR:bom00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102278637    04061 Viral protein interaction with cytokine and cytokine receptor     102278637  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     102278637  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bom04052]     102278637 Cytokines and neuropeptides [BR:bom04052]  Cytokines   Chemokines    102278637 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-GeneID:  102278637 NCBI-ProteinID:  XP_070231530 LinkDB All DBs Position 8:36733360..36734394 Genome browser AA seq 87 aa AA seqDB search MSGLRRYEVALEAEEEIYWGCFYFFPWLRMWRRERSSAHPREQKLEPLRGLMSCLSSGLG TAPQRSGRSLPRRTPAATTQPAGALKI NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgtcgggattgaggagatacgaggtggcgctggaggcggaggaggagatctactggggc tgcttctactttttcccctggctgcgcatgtggcgaagggagcggagctcggcgcaccct cgggagcagaagctggagcctctgcggggcctgatgagctgtctgtcaagtggcctgggc actgctccccagcgctccggccgcagcctcccccgccgcacccccgccgccactactcag ccagccggtgcattaaagatttaa

DBGET integrated database retrieval system