Bos mutus (wild yak): 102279265 Help Entry 102279265         CDS       T02919                                  Symbol SOD1 Name (RefSeq) superoxide dismutase [Cu-Zn]   KO K04565   superoxide dismutase, Cu-Zn family [EC:1.15.1.1] Organism bom  Bos mutus (wild yak) Pathway bom04146   Peroxisome bom04213   Longevity regulating pathway - multiple species bom05012   Parkinson disease bom05014   Amyotrophic lateral sclerosis bom05016   Huntington disease bom05020   Prion disease bom05022   Pathways of neurodegeneration - multiple diseases bom05208   Chemical carcinogenesis - reactive oxygen species Brite KEGG Orthology (KO) [BR:bom00001]  09140 Cellular Processes   09141 Transport and catabolism    04146 Peroxisome     102279265 (SOD1)  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     102279265 (SOD1)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     102279265 (SOD1)   09164 Neurodegenerative disease    05012 Parkinson disease     102279265 (SOD1)    05014 Amyotrophic lateral sclerosis     102279265 (SOD1)    05016 Huntington disease     102279265 (SOD1)    05020 Prion disease     102279265 (SOD1)    05022 Pathways of neurodegeneration - multiple diseases     102279265 (SOD1) Enzymes [BR:bom01000]  1. Oxidoreductases   1.15  Acting on superoxide as acceptor    1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)     1.15.1.1  superoxide dismutase      102279265 (SOD1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Sod_Cu Motif Other DBs NCBI-GeneID:  102279265 NCBI-ProteinID:  XP_070223295 LinkDB All DBs Position 1:complement(3088278..3096949) Genome browser AA seq 152 aa AA seqDB search MATKAVCVLKGDGPVQGTIHFEAKGDTVVVTGSITGLTEGDHGFHVHQFGDNTQGCTSAG PHFNPLSKKHGGPKDEERHVGDLGNVTADKNGVAVVDIVDSLISLSGEYSIIGRTMVVHE KPDDLGRGGNEESTKTGNAGSRLACGVIGIAK NT seq 459 nt NT seq  +upstreamnt  +downstreamnt atggcgacgaaggccgtctgcgtgctgaagggcgacggcccggtgcaaggcaccatccac ttcgaggcaaagggagatacagtcgtggtaactggatccattacaggattgactgaaggt gatcatggattccacgtccatcagtttggagacaatacacaaggctgtaccagtgcaggt cctcactttaatcctctgtccaaaaaacacggtgggccaaaagatgaagagaggcatgtt ggagacctgggcaatgtgacagctgacaaaaacggtgttgccgtcgtggatattgtagat tctctgatttcactctcaggagaatattccatcattggccgcacgatggtggtccatgaa aaaccagatgacttgggcagaggtggaaatgaagaaagtacaaagactggaaacgctgga agtcgtttggcctgtggtgtaattggaattgccaagtaa

DBGET integrated database retrieval system