Bos mutus (wild yak): 102280202 Help Entry 102280202         CDS       T02919                                  Symbol PFN4 Name (RefSeq) profilin-4   KO K05759   profilin Organism bom  Bos mutus (wild yak) Pathway bom04015   Rap1 signaling pathway bom04810   Regulation of actin cytoskeleton bom05014   Amyotrophic lateral sclerosis bom05132   Salmonella infection Brite KEGG Orthology (KO) [BR:bom00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     102280202 (PFN4)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     102280202 (PFN4)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102280202 (PFN4)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     102280202 (PFN4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bom04131]     102280202 (PFN4)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:bom04812]     102280202 (PFN4)    04147 Exosome [BR:bom04147]     102280202 (PFN4) Membrane trafficking [BR:bom04131]  Others   Actin-binding proteins    Others     102280202 (PFN4) Cytoskeleton proteins [BR:bom04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      102280202 (PFN4) Exosome [BR:bom04147]  Exosomal proteins   Proteins found in most exosomes    102280202 (PFN4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  102280202 NCBI-ProteinID:  XP_005895730 UniProt:  L8IJ91 LinkDB All DBs Position 11:complement(31778379..31781731) Genome browser AA seq 129 aa AA seqDB search MSHLQNLLLDTLLGTKHVDSAALIKLQERSLCVASPGFSVMPSDVRTLVNGFAKNPLKTR REGLYFKEKDYKCVRADDYSLYAKNENTGVIVVKTHLYLLVATYSEGMYPSVCVEATEKL GDYLRRKGN NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgagccatttgcagaacttactgttagatacactcctgggaacaaagcatgtggacagt gcagccctcatcaaactccaggagcggagcctatgtgtagcatcaccaggatttagtgta atgcccagtgatgtccgaacacttgtaaatgggtttgccaagaaccctttgaaaaccaga agagaaggactgtatttcaaggagaaggactacaaatgtgtccgggcagatgactattct ctttatgccaagaatgaaaacactggtgtgattgttgtgaagacccatctgtatcttctg gtggcaacttactctgaaggcatgtatcctagtgtctgtgtggaagccacagagaagttg ggagactatctaagaagaaaagggaattaa

DBGET integrated database retrieval system