Bos mutus (wild yak): 102280554 Help Entry 102280554         CDS       T02919                                  Symbol RHOA Name (RefSeq) transforming protein RhoA   KO K04513   Ras homolog gene family, member A Organism bom  Bos mutus (wild yak) Pathway bom04014   Ras signaling pathway bom04015   Rap1 signaling pathway bom04022   cGMP-PKG signaling pathway bom04024   cAMP signaling pathway bom04062   Chemokine signaling pathway bom04071   Sphingolipid signaling pathway bom04072   Phospholipase D signaling pathway bom04081   Hormone signaling bom04144   Endocytosis bom04150   mTOR signaling pathway bom04270   Vascular smooth muscle contraction bom04310   Wnt signaling pathway bom04350   TGF-beta signaling pathway bom04360   Axon guidance bom04510   Focal adhesion bom04520   Adherens junction bom04530   Tight junction bom04611   Platelet activation bom04621   NOD-like receptor signaling pathway bom04625   C-type lectin receptor signaling pathway bom04660   T cell receptor signaling pathway bom04670   Leukocyte transendothelial migration bom04722   Neurotrophin signaling pathway bom04810   Regulation of actin cytoskeleton bom04921   Oxytocin signaling pathway bom04928   Parathyroid hormone synthesis, secretion and action bom04972   Pancreatic secretion bom05100   Bacterial invasion of epithelial cells bom05132   Salmonella infection bom05133   Pertussis bom05135   Yersinia infection bom05152   Tuberculosis bom05163   Human cytomegalovirus infection bom05200   Pathways in cancer bom05203   Viral carcinogenesis bom05205   Proteoglycans in cancer bom05206   MicroRNAs in cancer bom05210   Colorectal cancer bom05417   Lipid and atherosclerosis bom05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:bom00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     102280554 (RHOA)    04015 Rap1 signaling pathway     102280554 (RHOA)    04310 Wnt signaling pathway     102280554 (RHOA)    04350 TGF-beta signaling pathway     102280554 (RHOA)    04072 Phospholipase D signaling pathway     102280554 (RHOA)    04071 Sphingolipid signaling pathway     102280554 (RHOA)    04024 cAMP signaling pathway     102280554 (RHOA)    04022 cGMP-PKG signaling pathway     102280554 (RHOA)    04150 mTOR signaling pathway     102280554 (RHOA)   09133 Signaling molecules and interaction    04081 Hormone signaling     102280554 (RHOA)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     102280554 (RHOA)   09144 Cellular community - eukaryotes    04510 Focal adhesion     102280554 (RHOA)    04520 Adherens junction     102280554 (RHOA)    04530 Tight junction     102280554 (RHOA)   09142 Cell motility    04810 Regulation of actin cytoskeleton     102280554 (RHOA)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     102280554 (RHOA)    04621 NOD-like receptor signaling pathway     102280554 (RHOA)    04625 C-type lectin receptor signaling pathway     102280554 (RHOA)    04660 T cell receptor signaling pathway     102280554 (RHOA)    04670 Leukocyte transendothelial migration     102280554 (RHOA)    04062 Chemokine signaling pathway     102280554 (RHOA)   09152 Endocrine system    04921 Oxytocin signaling pathway     102280554 (RHOA)    04928 Parathyroid hormone synthesis, secretion and action     102280554 (RHOA)   09153 Circulatory system    04270 Vascular smooth muscle contraction     102280554 (RHOA)   09154 Digestive system    04972 Pancreatic secretion     102280554 (RHOA)   09156 Nervous system    04722 Neurotrophin signaling pathway     102280554 (RHOA)   09158 Development and regeneration    04360 Axon guidance     102280554 (RHOA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102280554 (RHOA)    05206 MicroRNAs in cancer     102280554 (RHOA)    05205 Proteoglycans in cancer     102280554 (RHOA)    05203 Viral carcinogenesis     102280554 (RHOA)   09162 Cancer: specific types    05210 Colorectal cancer     102280554 (RHOA)   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     102280554 (RHOA)   09171 Infectious disease: bacterial    05132 Salmonella infection     102280554 (RHOA)    05135 Yersinia infection     102280554 (RHOA)    05133 Pertussis     102280554 (RHOA)    05152 Tuberculosis     102280554 (RHOA)    05100 Bacterial invasion of epithelial cells     102280554 (RHOA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102280554 (RHOA)    05418 Fluid shear stress and atherosclerosis     102280554 (RHOA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bom04131]     102280554 (RHOA)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bom04147]     102280554 (RHOA)    04031 GTP-binding proteins [BR:bom04031]     102280554 (RHOA) Membrane trafficking [BR:bom04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     102280554 (RHOA) Exosome [BR:bom04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102280554 (RHOA)   Exosomal proteins of other body fluids (saliva and urine)    102280554 (RHOA)   Exosomal proteins of colorectal cancer cells    102280554 (RHOA)   Exosomal proteins of bladder cancer cells    102280554 (RHOA) GTP-binding proteins [BR:bom04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     102280554 (RHOA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  102280554 NCBI-ProteinID:  XP_070215509 LinkDB All DBs Position 22:50826618..50876458 Genome browser AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ ARRGKKKSGCLVL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggctgccatccggaagaaactggtgattgttggagatggagcctgtggcaagacttgc ttgctcattgtctttagcaaggaccagttcccagaggtgtatgtccctacggtgtttgag aactatgtggcagatattgaagtggatggaaagcaggtagagttggctttatgggacaca gctgggcaggaagattatgatcgcttgaggcctctctcctacccggataccgacgttata ctgatgtgtttctccattgatagccctgatagtttagaaaacataccagaaaaatggact ccggaagtcaagcatttctgtcccaacgtgcccatcatcctggttgggaacaagaaggat cttcgaaacgacgagcacacaaggcgggagctggccaagatgaagcaggagccagtaaaa cccgaagaaggcagagatatggcaaacaggattggtgcttttgggtacatggagtgttca gcaaagaccaaagatggagtgagggaggtttttgaaatggccacgagagctgctctgcaa gccagacgtgggaagaaaaaatctgggtgccttgtcttgtga

DBGET integrated database retrieval system