Bos mutus (wild yak): 102280848 Help Entry 102280848         CDS       T02919                                  Name (RefSeq) histone H2B type 1-B   KO K11252   histone H2B Organism bom  Bos mutus (wild yak) Pathway bom04613   Neutrophil extracellular trap formation bom05034   Alcoholism bom05203   Viral carcinogenesis bom05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:bom00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     102280848  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     102280848   09163 Immune disease    05322 Systemic lupus erythematosus     102280848   09165 Substance dependence    05034 Alcoholism     102280848  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bom03036]     102280848   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bom04147]     102280848 Chromosome and associated proteins [BR:bom03036]  Eukaryotic type   Nucleosome assembly factors    Histones     102280848 Exosome [BR:bom04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102280848 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa Motif Other DBs NCBI-GeneID:  102280848 NCBI-ProteinID:  XP_005892277 UniProt:  A0A6B0S5Z2 LinkDB All DBs Position 23:complement(20053758..20054161) Genome browser AA seq 126 aa AA seqDB search MPEPSKSAPAPKKGSKKAITKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSSK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcctgagccgtctaaatctgctccggctcctaaaaaaggctctaagaaagccatcact aaggcacagaagaaagatggcaaaaaacgcaagcgcagtcgtaaagagagctactctatt tatgtgtacaaggttttgaagcaggtgcatcccgatactggtatctcatctaaggccatg ggtatcatgaactccttcgtgaacgacattttcgagcgcatcgccggcgaggcgtcacgc ctggcgcattacaacaagcgctcgaccattacatcccgggagatccagacggccgtgcgc ctgctgctgcccggggagctggccaagcatgctgtttctgagggtaccaaggccgtaact aaatacaccagctccaaatga

DBGET integrated database retrieval system