Bos mutus (wild yak): 102282265 Help Entry 102282265         CDS       T02919                                  Symbol FGF21 Name (RefSeq) fibroblast growth factor 21   KO K22429   fibroblast growth factor 21 Organism bom  Bos mutus (wild yak) Pathway bom04010   MAPK signaling pathway bom04014   Ras signaling pathway bom04015   Rap1 signaling pathway bom04020   Calcium signaling pathway bom04151   PI3K-Akt signaling pathway bom04714   Thermogenesis bom04810   Regulation of actin cytoskeleton bom05200   Pathways in cancer bom05218   Melanoma bom05224   Breast cancer bom05226   Gastric cancer Brite KEGG Orthology (KO) [BR:bom00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102282265 (FGF21)    04014 Ras signaling pathway     102282265 (FGF21)    04015 Rap1 signaling pathway     102282265 (FGF21)    04020 Calcium signaling pathway     102282265 (FGF21)    04151 PI3K-Akt signaling pathway     102282265 (FGF21)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     102282265 (FGF21)  09150 Organismal Systems   09159 Environmental adaptation    04714 Thermogenesis     102282265 (FGF21)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102282265 (FGF21)   09162 Cancer: specific types    05226 Gastric cancer     102282265 (FGF21)    05218 Melanoma     102282265 (FGF21)    05224 Breast cancer     102282265 (FGF21)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bom04052]     102282265 (FGF21)    00536 Glycosaminoglycan binding proteins [BR:bom00536]     102282265 (FGF21) Cytokines and neuropeptides [BR:bom04052]  Cytokines   Growth factors (RTK binding)    102282265 (FGF21) Glycosaminoglycan binding proteins [BR:bom00536]  Heparan sulfate / Heparin   Growth factors/receptors    102282265 (FGF21) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FGF Motif Other DBs NCBI-GeneID:  102282265 NCBI-ProteinID:  XP_005895443 UniProt:  L8IKI4 LinkDB All DBs Position 18:complement(7511978..7513702) Genome browser AA seq 209 aa AA seqDB search MGWDEAKFKHLGLWVPVLAVLLLGTCRAHPIPDSSPLLQFGGQVRQRYLYTDDAQETEAH LEIRADGTVVGAARQSPESLLELKALKPGVIQILGVKTSRFLCQGPDGKLYGSLHFDPKA CSFRELLLEDGYNVYQSETLGLPLRLPPQRSSNRDPAPRGPARFLPLPGLPAEPPDPPGI LAPEPPDVGSSDPLSMVGPSYGRSPSYTS NT seq 630 nt NT seq  +upstreamnt  +downstreamnt atgggctgggacgaggccaagttcaagcacttgggactgtgggtccctgtgctggctgtc ctcctgctaggaacctgccgggcgcatcccattccagactccagccccctcctccagttt gggggccaagtccgccagcggtacctctacacggatgatgcccaggagacagaggcccac ctggagatcagggccgatggcacagtggtgggggcagcccgccagagccccgaaagtctc ttggagctgaaagccctgaagccaggcgtcattcagatcttgggagttaaaacatccagg tttctctgccaggggccagatgggaagctgtatggatcgctgcactttgaccccaaagcc tgcagctttcgggagctgcttcttgaagatggatacaacgtctaccagtcggagaccctg ggccttccactccgcctgcccccccagcgctcgtccaaccgggacccggccccacgggga cctgctcgcttccttccactgccgggcctgcccgcggagcccccggatcctccagggatc ttggcccccgagcctcccgacgtgggctcctcggatcccctgagtatggtgggaccctcg tatggccgaagccccagctacacttcttga

DBGET integrated database retrieval system